SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000005119 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000005119
Domain Number 1 Region: 63-222
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.23e-36
Family MAM domain 0.0016
Further Details:      
 
Domain Number 2 Region: 20-59
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000733
Family LDL receptor-like module 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000005119   Gene: ENSECAG00000007089   Transcript: ENSECAT00000007082
Sequence length 224
Comment pep:novel chromosome:EquCab2:29:16383989:16412493:-1 gene:ENSECAG00000007089 transcript:ENSECAT00000007082 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDVAVDDISFQDCSPLLSPDRECTAQEFTCANKHCIAKDKLCDFVNDCADNSDESTFIC
STSSGRCDFEFDLCSWEQEQDDDFDWNLKASSIPAVGTEPAADHTLRNSSGHYIFIKSLF
PQQPMRTARISSPVISRRSKNCKIIFHYHMYGNSTRALALVQVSVSNQTKVLLNLTVEQG
NFWHRKEVSLSSDEDFQLKLEGRVGKGHDGDIALDDIVLTKSCL
Download sequence
Identical sequences F7DJC7
9796.ENSECAP00000005119 ENSECAP00000005119 ENSECAP00000005119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]