SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000005123 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000005123
Domain Number 1 Region: 74-260
Classification Level Classification E-value
Superfamily p53-like transcription factors 8.45e-71
Family T-box 0.00000155
Further Details:      
 
Domain Number 2 Region: 2384-2464
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000406
Family HLH, helix-loop-helix DNA-binding domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000005123   Gene: ENSECAG00000006544   Transcript: ENSECAT00000007089
Sequence length 3025
Comment pep:known_by_projection chromosome:EquCab2:1:146998113:147080723:-1 gene:ENSECAG00000006544 transcript:ENSECAT00000007089 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEKQQIILANQDGGTVAGTAPTFFVILKQPGNGKTDQGILVTNRDACALASSVSSPGKS
KGKICLPADCTVGGITVTLDNNSMWNEFYHRSTEMILTKQGRRMFPYCRYWITGLDSNMK
YILVMDISPVDNHRYKWNGRWWEPSGKAEPHVLGRVFIHPESPSTGHYWMHQPVSFYKLK
LTNNTLDQEGHIILHSMHRYLPRLHLVPAEKATEVIQLNGPGVHTFTFPQTEFFAVTAYQ
NIQITQLKIDYNPFAKGFRDDGLNSKPQRDGKQKNSSDQEGNSVPSSPGQRVRLTEGEGS
DIQLTDSDALSRGHETSGKGLEKPSLNVKRDFLGFMDIDSALGEVPQLKQEVSESLVANN
FEDGSHVASPLDPNGNFNVVIKEEPLDDYEYGLGECPEGVTVKQEETDEETDVYSNSDDD
PILEKQLKRHNKVDNLEADHPSSKWLPNSPSGVAKAKMFKLDAGKMPVVYLEPCAVTKST
VKISELPDNMLSTSRKDKSSVLTELDYLPMYIENSNETGFCLGKESENGLRKHSPDLRVV
QKYPSLKEPQWKYPDISDSFNTETILDSSKSSTGDSFLGKEDLGRKRATMLKISTASKAV
NANQNSPLNVPGKRGRPRKLKLSKAGRPPKNTGKSLTSTKNTPLGPGSTFPDVKPDLEDV
DGVLFVSFESKEALDIHAVDGTTEEPCSLQASTTNDPVCVASNPQMRKSKLEDSHTFPTS
ALLHIVIHELGLKLNSVDPTMSIDLKYLGVQLPLAPATSFPFWNLTGTNPASPDAGFPFV
SRTGKTNDFTKIKGWRGKFHSASASRNEGGNSEGSLKNRSAFCSDKLDEYLENEGKLMET
NMGFSSSAPTSPVVYQLPTKSTSYVRTLDSVLKKQSTISPCTSYSLKPHSVPSASRKVKS
QNKQATFSGRTKSSYKSILPYPISPKQKHTHIIPGDKVTKNSSSTISENPVNNFVVPTLD
ENTFPKQISLRQAHQQQQQQQQGTRPPGLSKSQVKLMDLEDCALWEGKPRTYITEERADV
SLTTLLTAQASLKTKPIHTIIRKRAPPCNNDFCRLGCVCSSLALEKRQPAHCRRPDCMFG
CTCLKRKVVLVKGGSKTKHFQRKAAHRDPVFYDTLGEEQREGEEGVKEEEEQLKEKKKRK
KLEYTICETEPEQPVRHYPLWVKVEGEVDPEPVYIPTPSVIEPMKPLLLPQPEVLSTTVK
GKLLTGIKPARAYTPKPNPVIREEDKDPVYLYFESMMTCARVRVYERKKAEQKQPSPSAS
PSFQQQGSCHSSPENCNAKELNSEQQPLKPITCDLEDDSDKSQEKSWKSSCNEGESSSTS
YVHQRSPGGPTKLIEIISDCNWEEDRNKILSILSQHINSNMPQSLKVGSFIIELASQRKS
RGEKNPPVYSSRVKISMPSCQDQDDMAEKSGSETPDGPLSPGKMDDISPVQTDALDSVRE
RLHGGKGLPFYAGLSPAGKLVAYKRKPSSSTSGLIQVASNAKVAASRKPRTLLPSTSNSK
TASSSGTTTNRPGKNLKAFVPAKRPIAARPSPGGVFTQFVMSKVGALQQKIPGVSTPQPL
TGPQKFSIRPSPVMVVTPVVSSEPVQVCSPVTAAVTTTTPQVFLENVTAVTPMTAISDVG
AKETTSGATTAGVVEVSETNTSTPVTPTQSAATVNLIKTTGITTPVASVAFPKSLVASPP
TITLPVASTASTSIVVVTTAASSSMVTTPTSSLGSVPIILSGIDGNPPVSQRPENAPQIP
VATSQVSPNTVKRPGPRLLHPNGQIVQLLPLHQLRGSNTQPNLQPVVFRNPGSVMGIRLP
TPSKPSETPPSSASSSAFSVMNPVIQAVGSSPAVNVITQAPSLLSSGPSFVSQSGTLTLR
ISPPEPQSFASKTGSETKITYSSGGQPVGTASLIPLQSGSFALLQLPGQKPVPSSILQHV
ASLQMKRESQNADQKDETSFLKREQEAKKALQSEGDAIDSETNIIKQNSGAPASEEILND
SLEDEGDHLDEESLIEEDPATVKPSEHSCISGSHIGEDYKDTDEEYGITNHNSSKEKLTV
LEVKTISEKASDMTVQSVSNVQFKKPGGVKMELQKGLVDPEEKSNEFPVISKEESKLELS
GSTVVEQQSNLQPEAKEKGCGDSLEKDSIRERWRKHLKGPLTEKCVGTSQECKEEADEQL
IKETKTCSENSDVFQQEQGISDLLGKNGTTENTRILKTECDSWSRISSPAAFSVVPKRAP
KGSRGEGHFQGHLMLSGEHIQPKQEKKGGRSSADFAVLDLEEEDEEDENDKTDDSIDEIV
DVVSDYQSEEVDDVEKNNCVEYIEDDEEQVDIETVEELSEEINVAHIKTTAAHTQTFKQP
CRTHISADEKAAEKSRKAPPIPLKLKPDYWSEKLQKEAEAFAYYRRTHTANERRRRGEMR
DLFEKLKITLGLLHSSKVSKSLILTRAFSEIQGLTDQADKLIGQKNLLTRKRNILIRKVS
SLSGKTEEVVLKKLEYIYAKQQALEAQKRKKKMGSDEFDVSPRTSKQQEGSSASSVDLGQ
MFLNNRKGKPLILSRKRDQTTENTSPSNTPHTSANIVMTPQGQLLTLKGPLFSGPVVTVS
PALLEADLKPQVASSAMAQSENDDLFMMPRIVNVTSLATEGGLVEMGGSKYPHELPDGKP
PDHLQNTVRNEDNSFEDSGRISSRGNHRDGRMALGPTQVFLANKDSGFPQIVDVSSMQEA
QEFLPKKISGDMRGIQYKWKESESRRERLKPKESPFHKLKMKDLKDSSIEMELRKVASAI
EEAALDPNELLTNMEDEDDTDETLTSLLNEIAFLNQQLNDDSVSLAELPSSMDAEFPGDA
RRAFISKLPPGNRTTFQVGHLGTDLKELPDVQGESDSVSPLLLHLEDDDFSESEKQLAEP
ASEPDVLKIVIDSEIKDPLLSHRKANDGGKNTSGVPAEPESVSSPPVLHMKAGLENSSTD
TLWRPMPKLAPLGLKVANPSSDADGQSLKVMPCLAPVAAKVGSVGHKINLTGNDQECRES
KVMPTLAPIVAKLGNSGASPSSAGK
Download sequence
Identical sequences F7DJB1
ENSECAP00000005123 ENSECAP00000005123 9796.ENSECAP00000005123

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]