SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000005475 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000005475
Domain Number 1 Region: 209-345
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.06e-35
Family MAM domain 0.0024
Further Details:      
 
Domain Number 2 Region: 1-162
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.4e-34
Family MAM domain 0.0035
Further Details:      
 
Domain Number 3 Region: 173-207
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000419
Family LDL receptor-like module 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000005475   Gene: ENSECAG00000007484   Transcript: ENSECAT00000007489
Sequence length 346
Comment pep:novel chromosome:EquCab2:29:16521175:16526465:-1 gene:ENSECAG00000007484 transcript:ENSECAT00000007489 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CDFEANSCGWFEAVSGDDFDWTWSSRSNLPAEFEQQAPPQDHTHNTAQGHFMFILKKSSS
LSQIAKLQSPTFSQTGPGCTFSFWFYNYGLSVGAAELLLHMENSNESTVLWRVLYNQGNQ
WSQATIQLGRLTEPFHFSLSKVSLGIYGGVSAIDDITFENCTLPLPVESCEGPDHFWCPH
TKACIEKLQLCDLLDDCGDRADEVDCVHELQCNFENGVCNWEQDTEDDFDWTRYQGPTPT
LNTGPMKDNTLGTAKGHYLYIESSEPQVFQNRAALLSPILNATNTEGCSFRLYYHMFGKR
IYRLAIYQRIWSNTRGQLLWEIFGNQGNRWIRKHLNISSRQPFQVW
Download sequence
Identical sequences F7DDF4
ENSECAP00000005475 ENSECAP00000005475 9796.ENSECAP00000005475

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]