SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000005547 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000005547
Domain Number 1 Region: 467-618
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.34e-61
Family Ankyrin repeat 0.0000164
Further Details:      
 
Domain Number 2 Region: 6-223,258-283
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 5.36e-51
Family BAR domain 0.013
Further Details:      
 
Domain Number 3 Region: 241-346
Classification Level Classification E-value
Superfamily PH domain-like 2.12e-18
Family Pleckstrin-homology domain (PH domain) 0.0078
Further Details:      
 
Domain Number 4 Region: 389-467
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 0.00000000000000191
Family Pyk2-associated protein beta ARF-GAP domain 0.0000665
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000005547   Gene: ENSECAG00000007189   Transcript: ENSECAT00000007569
Sequence length 827
Comment pep:known_by_projection chromosome:EquCab2:2:31427141:31447765:1 gene:ENSECAG00000007189 transcript:ENSECAT00000007569 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVLEGDQALLQRVKKAVRAIHSSGLGHVENEEQYREAVESLGNSHLSQNSHELSTGFLNL
AVFTREVAALFKNLVQNLNNIVSFPLDSLLKGQLRDGRQDSKKQLEKAWKDYEAKMARLE
KERDRARVTGGSPGEVAQDTQRERRVFQLHMCEYLLKAGESQMKQGPDFLQSLIKFFHAQ
HNFFQDGWKAAQSLSPFIEKLAASVHALRQAQEEELQKLTQLRDSLRGTLQLESREENLS
RKNSGGGYSIHQHQGNKQFGTEKVGFLYKKSDGIRRVWQKRKCGVKYGCLTISHSTINRP
PVKLTLLTCQVRPNPEEKKCFDLVTHNRTYHFQAEDEHECEAWVSVQNSKDEALSSAFLG
EPGVGPGPWGGAGWTGSPKDLTKLLIAECSGHRELGVRFSRMQSLTLDLLGPSELLLALN
IGNTRFNEVMEAQLPSHGGPKPSAESDMSARRDYIVAKYVEHRFARRSTPEPQRLWMAIC
NRDLLSVLEAFANGQDFGQLLPGPEGQAPGELALHLAVRVASQASLPLVDFIIQNGGHLD
AKAADGNSALHYAALYNQPDCLKLLLKGRAAAGSVNEAGETALDIARKKQHKECEELLEQ
AQAGTLAFPLHVDYPWGISPEPGSDSEEDEEEKRCSLKPPAQVRWASGRLDISNKTYETF
ASLGPAPQSQSEDCPPPLPVKNPSRTVVQGRAGHASGDRSEVPSLSSEAPGASESLSSPA
SSSSSLTSPVEPGGPSQSPHGSEEGLWEPSGASRPSLTSGTTPAEMYPPVRFSSESTRSY
RRGARSPEDCPTARQPLPRRNMPVGFTEGEGSRTGVLPASSVQLLQD
Download sequence
Identical sequences F7CQV7
ENSECAP00000005547 ENSECAP00000005547 9796.ENSECAP00000005547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]