SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Equus caballus 76_2 > ENSECAP00000005579

Domain assignment for ENSECAP00000005579 from Equus caballus 76_2

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSECAP00000005579
Domain Number 1	Region: 163-256
Classification Level	Classification	E-value
Superfamily	Immunoglobulin	2.52e-21
Family	I set domains	0.0099
Further Details:

Domain Number 2	Region: 80-170
Classification Level	Classification	E-value
Superfamily	Immunoglobulin	1.06e-16
Family	I set domains	0.021
Further Details:

Domain Number 3	Region: 2-84
Classification Level	Classification	E-value
Superfamily	Immunoglobulin	0.000000000296
Family	I set domains	0.079
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Biological Process	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSECAP00000005579 Gene: ENSECAG00000007574 Transcript: ENSECAT00000007604
Sequence length	289
Comment	pep:known_by_projection chromosome:EquCab2:7:40440183:40610628:1 gene:ENSECAG00000007574 transcript:ENSECAT00000007604 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	RCTIDNRVTRVAWLNRSTILYAGNDKWCLDPRVVLLSNTQTQYSIEIQNVDVYDEGPYTC SVQTDNHPKTSRVHLIVQVSPKIVEISSDISINEGNNISLTCIATGRPEPTVTWRHISPK AVGFVSEDEYLEIQGITREQSGDYECSASNDVAAPVVRRVKVTVNYPPYISEAKGTGVPV GQKGTLQCEASAVPSAEFHWYKDDKRLVEGKKGVKVENRPFLSKLIFFNVSEHDYGNYTC VASNKLGHTNASITLFGPGAVSEVNNGTSRRAGCIWLLPLLVLHQLLKF
Download sequence
Identical sequences	F7CKN0 ENSECAP00000005579 ENSECAP00000005579 9796.ENSECAP00000005579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]