SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000005739 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSECAP00000005739
Domain Number - Region: 47-108
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0207
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000005739   Gene: ENSECAG00000007759   Transcript: ENSECAT00000007776
Sequence length 291
Comment pep:novel chromosome:EquCab2:4:104766812:104767684:-1 gene:ENSECAG00000007759 transcript:ENSECAT00000007776 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRTQRNTFQAREQDKTPEKELNETEINNLSAKEFKQKVIKMLTDLGRRMDELSENVNKEL
ENIKKNRSEMKNTILEMKNSLKGLNNRVDDKGEWISELDERLEEITQAEQTKEKRMKKNE
KSLGELWDNIKCTNIHIIGVPEGEEKDKGSENLFEEIITEKFPDLRKETDIKVQEAQRSP
NKISLTRPTPRHIIIKMSKITDKERILKAVRERQQVTYKGNPIRLSVDFSVETLQDRREW
HNIIKVLKGTNLQPRILYPARLPFRMEGEIKSFPDKQNLKEFTTKKPSLQE
Download sequence
Identical sequences F7DHT1
9796.ENSECAP00000005739 ENSECAP00000005739 ENSECAP00000005739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]