SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000005919 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000005919
Domain Number 1 Region: 1923-2052
Classification Level Classification E-value
Superfamily C-type lectin-like 2.27e-43
Family C-type lectin domain 0.00000047
Further Details:      
 
Domain Number 2 Region: 483-590
Classification Level Classification E-value
Superfamily C-type lectin-like 2.87e-42
Family Link domain 0.0017
Further Details:      
 
Domain Number 3 Region: 150-260
Classification Level Classification E-value
Superfamily C-type lectin-like 1.16e-39
Family Link domain 0.0015
Further Details:      
 
Domain Number 4 Region: 594-710
Classification Level Classification E-value
Superfamily C-type lectin-like 7.63e-29
Family Link domain 0.0051
Further Details:      
 
Domain Number 5 Region: 261-355
Classification Level Classification E-value
Superfamily C-type lectin-like 1.41e-28
Family Link domain 0.0026
Further Details:      
 
Domain Number 6 Region: 33-151
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000857
Family V set domains (antibody variable domain-like) 0.023
Further Details:      
 
Domain Number 7 Region: 2053-2111
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000598
Family Complement control module/SCR domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000005919   Gene: ENSECAG00000007493   Transcript: ENSECAT00000007976
Sequence length 2138
Comment pep:known_by_projection chromosome:EquCab2:1:94344393:94381944:-1 gene:ENSECAG00000007493 transcript:ENSECAT00000007976 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTLLLAFVTLRVITAAISVDVSDPDNSLSVSIPEPSPLRVLLGTSLTIPCYFIHPTHPV
TTAPSTAPLAPRIKWSRISKEKEVVLLVATEGQVRVNSAYQDRVSLPNYPAIPTDATLEL
QNLRSNDSGIYRCEVMHGIEDSEATLEVVVKGIVFHYRAISTRYTLDFDRAQRACLQNSA
IIATPEQLQAAYEDGFHQCDAGWLADQTVRYPIHLPREGCYGDKDEFPGVRTYGIRDTNE
TYDVYCFAEEMEGEVFYATSPEKFTFHEAANECRRLGARLATTGQLYLAWQSGMDMCSAG
WLADRSVRYPISKARPNCGGNLLGVRTVYLHANQTGYPDPSSRYDAICYTGEDFVDIPEN
FFAVSGEEDITIQTVTWPDVEMPLPQNITEGEARGNVILTVKPIFGVSPTILEPGEPFTS
VPGVGTTAFPEAENETGAATRPWGIPEESTPGLGPITAFTSEDLVVQVTTAPEVPGQPRL
PGGVVFHYRPGSDRYSLTFEEAQQACLQTGAVIASPEQLQAAYEAGYEQCDAGWLSDQTV
RYPIVSPRTPCVGDMDSSPGVRTYGVRPSSETYDVYCYVDRLEGEVFFATRLEQFTFREA
LEFCGSHNATLATTGQLYAAWSRGLDKCYAGWLADGSLRYPIVTPRPACGGDKPGVRTVY
LYPNQTGLPDPLSRHHAFCFRGVSVAPSPGEEEAGTPTLPSGVEDWLVTQVAPGVAAVPL
GEETTAIPAFTVEPENQTEWEPAYTPLAASPLPGIPPTWPPTSAATEESTEGPWATEVPS
ASEKPSPSEEPSTLSAPVPIETELPSPGEPSGVPEVSGDFTGSGEVSGHLDFRGQPSEGS
VSGLPSGDLDSSGLISAVGSGLHVGSGLASGDEDRIRWSTTPAVGWLPSGSEGPEPTASG
AEDLSGLPSGGEVHLEPTASGVEDLSGLPSGGEIHLEPTASGVEDLGELPSGGEIHLEPT
ASGVEDLGELPSGGEVHVEPTASGVEDISGFPSGGEVHVEPTASGVEDLSGLPSGGEIHL
EPTASGVEDLGGLPSGEEIHLEPTASGVEDISGFPSGEEVHLEPTAPGIEDLSGLPSGGE
IHVEPTASGVEDISGFPSGEEVHLEPTASGDLGGLPSGGEIHLEPTPSGVEDLGGLPSGG
EVHLEPTASGIEDLGGLPSGGEIHLEPTASGVEDLGGLPSGGEVHLEPTASGVEDLSGLP
SGMEGLETSASGAEDLSGLPSGREDLFGSASGALDFGRIPSGSGQAPEASGLPSGFSGEY
SGVDLGSGPSSGLPDFSGLPSGFPTVSLVDTTLVEVVTATTAGQLEGRGTIGISGAGETS
GLPLSELDISGGASGLPSGAELSGQASGSPDISGETSGLFGVSGQPSGFPDISGGTSGLF
EVSGQPSGFSGETSGVTEFSGLSSGQPDVSGEASGVLFGSGQPFGITDLSGGASGVHDLS
GQPSGLPGFSGTTSGIHDLVSSAMSGSGEPSGITFVDTSLVEVTPTPFKEEEGLGSVELS
GLPSGDADLSGTSGRADVSGQSSGAPDSSGLTSQPPELSGLPSGVAEVSGESSGAETGSS
LPSGAYDGSGLPSGLPTVSLVDRTLVESVTQAPTAQEAGEGPSGILELSGAHSGAPAVSG
DHSGFSDLSGLPSGLVEPSGEPSSTPHFSGDFSGTIDVSGASSAATSTSGEASGLPEITL
ITSEFVEGVTEPTVSQELGQRPPVTFTPQLVESSGEASASGEAGGATPGFPGAGVEASSV
PESGHETSAYPEAGVVASAAPEASGGASGSPDLSAATSASREADLDGGSGLGVSGSTSPF
HEGPREGSASPEASGVSTTTYHVGTEASGWPSAAPAASRDRTDSSGDPSGHTSGPDVVLS
TSLPESEWTPQMQRPAEALLEIESSSPLYSGEETPTAETAVSPTEASIPASPGGPGVSET
AVTDQELCENGWTKFQGHCYRYFPDRETWVDAESRCREQQSHLSSIVTPEEQEFVNNNAQ
DYQWIGLNDRTIEGDFRWSDGHSLQFENWRPNQPDNFFTAGEDCVVMIWHEKGEWNDVPC
NYQLPFTCKKGTVACGDPPVVEHARTFGRKKARYEINSLVRYQCTEGFVQRHVPTIRCQP
SGQWEEPRITCTDPASYKRRLQKRSSRAPRRSRPSTAH
Download sequence
Identical sequences F7C3C6
9796.ENSECAP00000005919 ENSECAP00000005919 ENSECAP00000005919

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]