SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000006024 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000006024
Domain Number 1 Region: 409-547
Classification Level Classification E-value
Superfamily TIMP-like 1.61e-24
Family Netrin-like domain (NTR/C345C module) 0.014
Further Details:      
 
Domain Number 2 Region: 189-285
Classification Level Classification E-value
Superfamily Immunoglobulin 1.81e-21
Family I set domains 0.023
Further Details:      
 
Domain Number 3 Region: 360-416
Classification Level Classification E-value
Superfamily BPTI-like 4.54e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.002
Further Details:      
 
Domain Number 4 Region: 109-160
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000108
Family Ovomucoid domain III-like 0.039
Further Details:      
 
Domain Number 5 Region: 310-356
Classification Level Classification E-value
Superfamily BPTI-like 0.000000000241
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.017
Further Details:      
 
Domain Number 6 Region: 31-77
Classification Level Classification E-value
Superfamily Elafin-like 0.000000484
Family Elafin-like 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000006024   Gene: ENSECAG00000007997   Transcript: ENSECAT00000008094
Sequence length 553
Comment pep:known_by_projection chromosome:EquCab2:13:42009977:42012398:-1 gene:ENSECAG00000007997 transcript:ENSECAT00000008094 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LAVPMPALRPLLLLLLMVGLTLGASLPPGPRSHPGMCPNQLSPNLWVDAQSTCERECAGD
QDCTAAEKCCTNVCGLQSCVAARFPDGSLATPAPAASCKGFVCPQQGSDCDIWDGQPVCR
CRDRCEKEPSFTCASDGLTYYNRCYMDAEACLRGLRLHVVPCKHVLSWPPSSPGPPETTA
RPTPGDAPVPPALYSSPSPQAVYVGGTASLHCDVSGRPPPVVTWEKQSDQRENLIMRPDQ
MYGNVVVTSIGQLVLYNARPEDAGLYTCTARNAAGLLRADFPLSVIQRELARDRAPSAPA
PAECLPEAQACAGPPSSRVLWHFDPQRGSCMTFPVGSCDGGARGFETYEACQQACARGPG
DACVLPAVQGPCQGWEPRWAYSPLLQQCHPFEYGGCEGNGNSFESRESCEEACPVPRTPP
CPACRLRSKLALSLCRSDFAIVGRLTEVLEEPEAGSGGIARVALDDVLKDDKMGLKFLGT
KYLEVTLSGMDWACPCPNVTAGDGPLVIMGEVRDGVAVLDAGSYVRAASEKRVKKILELL
EKKACELLNRFQD
Download sequence
Identical sequences F6WEE0
ENSECAP00000006024 ENSECAP00000006024 9796.ENSECAP00000006024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]