SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000006041 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000006041
Domain Number 1 Region: 2-289
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 6.54e-53
Family BAR domain 0.0098
Further Details:      
 
Domain Number 2 Region: 402-518
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 9.29e-44
Family Pyk2-associated protein beta ARF-GAP domain 0.00022
Further Details:      
 
Domain Number 3 Region: 261-365
Classification Level Classification E-value
Superfamily PH domain-like 1.81e-27
Family Pleckstrin-homology domain (PH domain) 0.0047
Further Details:      
 
Domain Number 4 Region: 667-783
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.9e-25
Family Ankyrin repeat 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000006041   Gene: ENSECAG00000007315   Transcript: ENSECAT00000008115
Sequence length 829
Comment pep:known_by_projection chromosome:EquCab2:2:48329107:48343577:1 gene:ENSECAG00000007315 transcript:ENSECAT00000008115 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVEFEECIKDSPRFRCARSAAALLLLPLSCPQLVKLCSGMIEAGKAYVTTNRLFVSGVR
DLSQQCQGDTVISECLQRFGDSLQEMVNYHMILFDQAQRSVRQQLHNFIKEDVRKFKETK
KQFDKVREDMELSLVRNAQAPRHRPHEVEEATGALTLTRKCFRHLALDYVLQVSHWAWSG
RLASLGAPLARENPRCQILGRDVGEVPRQRPRGLKDLAEEGLGGTWSRAVEKREMERKHA
IQQRTLLQDFSYDEPKAEFDVDAPSGVVMEGYLFKRASNAFKTWNRRWFSIQNSQLVYQK
KLKDVLTVVVDDLRLCSVKPCEDIERRFCFEVVSPTKSCMLQADSEKLRQAWVHAVQASI
ASAYRESPDSCYSERLDRTASPSTSSIDSATDSRERSVKGESVLQRVQNVAGNSQCSDCG
QPDPRWASINLGVLLCIECSGIHRSLGVHCSKVRSLTLDSWEPELLKLMCELGNSTMNHI
YEAQCEGLGSRKPTASSPRQDKEAWIKDKYVEKKFLRKPPSAPAREAPRRWRAQKCQRHH
SSPRAPTARRKIRLEPILPSVAALSSAGTVERPPPLTLVPHPLQQALAHFEAGAAAAGPR
SLSSDSGLGGSSDGSSDVLAFGAGSVVDSVTEEEGAESEESSGEADGESEAWGLADVREL
HPGLLAHRAARTRDLPALAAALAHGAEVNWADSEDEGKTPLVQAVLGGSLIVCEFLLQNG
ADVNQRDSRGRAPLHHATLLGRTGQVCLFLKRGADQHALDHEQQDPLSIAVQEANADIVT
LLRLARMAEEMREAEAPPGQPGPLAGSSPTELQYRRCIQEFISLHLEES
Download sequence
Identical sequences F6W7I4
ENSECAP00000006041 ENSECAP00000006041 9796.ENSECAP00000006041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]