SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000006096 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000006096
Domain Number 1 Region: 1109-1197
Classification Level Classification E-value
Superfamily Immunoglobulin 2.13e-19
Family I set domains 0.036
Further Details:      
 
Domain Number 2 Region: 1024-1106
Classification Level Classification E-value
Superfamily Immunoglobulin 2.23e-19
Family I set domains 0.01
Further Details:      
 
Domain Number 3 Region: 717-776
Classification Level Classification E-value
Superfamily BPTI-like 7.66e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0024
Further Details:      
 
Domain Number 4 Region: 885-965
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000215
Family I set domains 0.028
Further Details:      
 
Domain Number 5 Region: 276-334
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000484
Family TSP-1 type 1 repeat 0.0063
Further Details:      
 
Domain Number 6 Region: 9-57
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000109
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Domain Number 7 Region: 340-402
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000314
Family TSP-1 type 1 repeat 0.0026
Further Details:      
 
Domain Number 8 Region: 401-458
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000051
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 
Domain Number 9 Region: 458-516
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000196
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000006096   Gene: ENSECAG00000007861   Transcript: ENSECAT00000008176
Sequence length 1255
Comment pep:known_by_projection chromosome:EquCab2:24:18956880:18982471:1 gene:ENSECAG00000007861 transcript:ENSECAT00000008176 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APQLRQQSDTWGLWGNWSPCSRTCGGGVSFRERPCYSQRGDGGSSCVGPARNHRSCRTEV
KPTQCAEFDGREFQGRRYRWLPYYRAPNKCELNCIPEGESFYYKHKEAVVDGTPCEPGKR
DVCVEGSCRVVGCDYNLDSSKQEDKCLQCGGDGTTCYPVTGTFEANDLSRGYNQILIVPT
GATSVLIEEAAASRNFLAVKNIRGQYYLNGHWTVEGARALPVASTFLHYERGAEGDLAPE
RLHARGPTSEPLVIELISQEPNPGVRYEYYLPWGAPRPGFSWSHGSWSDCSAECDGGHQS
RLVFCTFDNEAYPDHMCQHQLRPADRRPCSPHPCPQTKRWKTGPWAPCSASCGGGSQSRS
VYCVSSSGAGVQEAAEEAAEEAECAGLPGKPPATQACNLQRCAAWSAGPWGECSVSCGAG
VRRRSVTCQGDKGSLLHATACSLEDQPPLTEPCLHDDCPPINDQAWHVGAWGLCSKSCSS
GMRRRQVLCTKGPPGYCRSLQLSKPVDVEPCNTQPCHLPPEVPSTQDMHSSPRDSWMSLG
PWEAPTSESRNQWWAPQERPSAQGNPRRDPDPHLPALGLAPSLQPSPHRQPQRSGLGPRD
CRHSPYGCCPDGHTASLGPEWQGCPGASCQQSRYGCCPDGMSVAEGPHQAGCARSYGGDA
RNRLGSRAVASTVPKAHWPQAQQNEPSECRGSQFGCCYDNVASAAGPLGEGCVGQPSYAY
PVRCLLPSAHGSCTDWAAHWYFIASVGQCNRFWYGGCHGNANNFVSEEECMSSCRRPQLG
PHRPEPGASGQSTHRDGGGSSPGGQQEANQHRMEATVQRKPFPSGGRRWQDRQPGQEEAH
HTQAFGERPWGQELGPSAPRQGGDAGRPAPPSQSSSYRITLAGSELSPVQVALGQLVRLF
CPDDPSLDSQAWWQKDGGPISSDRHKLQPDGSLVISPLRAEDAGTYSCGGTRPGADSQKI
QLQITGGDMAVLSEAELRHFPQTRDPAQGRSPQDSSLGGDAEGLGATSSSHPWPTTRLHL
DRNQPGVVDAHPGQQIRLICRAEGFPPPAIEWQRDGQPLSSPRHQLQPDGSLVIRHVAVE
DGGFYACVAFNGQDRDQRWVRLRVLGELTITGLPSTVTVPEGDTARLLCVVAGENVNIRW
SRNGLPVWADGHRVHQSPDGTLLIHNLRARDEGSYTCSAYRGSQAVSRSTEVKVVPPALA
AQPRDPSRECIDQPELANCDLILQAQLCGNEYYSSFCCASCSRFQPHAQPIWQQG
Download sequence
Identical sequences F6VT48
ENSECAP00000006096 9796.ENSECAP00000006096 ENSECAP00000006096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]