SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000006196 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000006196
Domain Number 1 Region: 42-222
Classification Level Classification E-value
Superfamily p53-like transcription factors 2.98e-78
Family T-box 0.0000000124
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000006196   Gene: ENSECAG00000007994   Transcript: ENSECAT00000008290
Sequence length 435
Comment pep:known_by_projection chromosome:EquCab2:31:6884739:6893405:-1 gene:ENSECAG00000007994 transcript:ENSECAT00000008290 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSPGTEGAGKSLQYRVDHLLSAVESELQAGSEKGDPTERELRVALEESELWLRFKQLTN
EMIVTKNGRRMFPVLKVNVSGLDPNAMYSFLLDFVAADNHRWKYVNGEWVPGGKPEPQAP
SCVYIHPDSPNFGAHWMKAPVSFSKVKLTNKLNGGGQIMLNSLHKYEPRIHIVRVGGPQR
MITSHCFPETQFIAVTAYQNEEITALKIKYNPFAKAFLDAKERSDHKDMMEEPGDSQQSG
YSQWGWLIPGTSTLCPPATPHPQFGGPLSLPASHGCERYPALRNHRPSPYPSPYAHRNNS
PTYSDNSSACLSMLQSHDNWPSLGMPAHTSMLPMSPNTGPAAGSSQYPSLWSVSNGTITP
GAQTAAMSNGLGAQFFRGSPTHAAPLAHPVSAPSSSGSPLYEGTATATDIPDSQYDASAQ
ARLIASWTPVSPPSM
Download sequence
Identical sequences F6UF53
9796.ENSECAP00000006196 ENSECAP00000006196 XP_001489978.2.31192 ENSECAP00000006196

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]