SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000006201 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000006201
Domain Number 1 Region: 118-226
Classification Level Classification E-value
Superfamily Second domain of FERM 4.06e-28
Family Second domain of FERM 0.0029
Further Details:      
 
Domain Number 2 Region: 228-371
Classification Level Classification E-value
Superfamily PH domain-like 8.91e-25
Family Third domain of FERM 0.0026
Further Details:      
 
Domain Number 3 Region: 16-118
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000000241
Family First domain of FERM 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000006201   Gene: ENSECAG00000007999   Transcript: ENSECAT00000008297
Sequence length 622
Comment pep:known_by_projection chromosome:EquCab2:1:185253267:185285419:1 gene:ENSECAG00000007999 transcript:ENSECAT00000008297 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKLNFHNNRVMQDRRSVCIFLPNDESLNIIINVKILCHQLLVQVCDLLRLKDCHLFGLS
VIQNNEHVYMELSQKLHKYCPKEWKKEASKVRPHDVTWGIDQFGPPMIIHFRVQYYVENG
RLISDRAARYYYYWHLRKQVLRSQCVLREEAYFLLAAFALQADLGNFKRNKHYGKYFEPE
AYFPSWVVSRRGKDYILKHIPNMHRDQFALTASEAHLKYIKEAVRLDDVAVHYYRLYKDK
RELEASLTLGLTMRGIQIFQNVDEEKQLLYDFPWTNVGKLVFVGKKFEILPDGLPSARKL
IYYTGCPLRSRHLLQLLSNSHRLYMNLQPVLRHVRKLEESEEKKQYRESYISDSLELDMG
PLEQRSRASGSSAGSARHKRLSRHSTASHGSSHTSGIEADTKPRDAGPEDGYSSGAVHRK
LKTCSSTTSHGSSHTSGVESGGKDHLEEGSQDDEIEMLVDDPRDLEQMHEESLEVSPDMC
IYITEDMLMSRKLNGHSGLIVKEIGSSTSSSSETVVKLRGQSTDSLPQTVCRKPKSSTDR
HSLSLDDIRLYQKDFLRIAGLCQDTAQSYTFGCGHGLGQEGLYCSSCLAQQSVHIQDALP
VKRASKYFSLDLTHDDVPEFVV
Download sequence
Identical sequences F6TS23
9796.ENSECAP00000006201 XP_003363732.1.31192 ENSECAP00000006201 ENSECAP00000006201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]