SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000006210 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000006210
Domain Number 1 Region: 1-163
Classification Level Classification E-value
Superfamily p53-like transcription factors 2.9e-74
Family p53 DNA-binding domain-like 0.000000045
Further Details:      
 
Domain Number 2 Region: 195-233
Classification Level Classification E-value
Superfamily p53 tetramerization domain 0.0000000000068
Family p53 tetramerization domain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000006210   Gene: ENSECAG00000008126   Transcript: ENSECAT00000008309
Sequence length 269
Comment pep:known chromosome:EquCab2:11:50611872:50615013:-1 gene:ENSECAG00000008126 transcript:ENSECAT00000008309 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YSPTLNKLFCQLAKTCPVQLLVSSPPPPGTRVRAMAIYKKSEFMTEVVRRCPHHERCSDS
SDGLAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNFMCNSSCMG
GMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENFRKKEEPCPEPPPRST
KRVLSSNTSSSPPQKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQTGKEPGGSKA
HSSHLKSKKGQSTSSHKKLIFKREGPDSD
Download sequence
Identical sequences F6TL72
ENSECAP00000006210 ENSECAP00000006210 9796.ENSECAP00000006210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]