SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000006233 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000006233
Domain Number 1 Region: 3-190
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 1.73e-56
Family alpha-catenin/vinculin 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000006233   Gene: ENSECAG00000008248   Transcript: ENSECAT00000008337
Sequence length 234
Comment pep:novel chromosome:EquCab2:1:54728163:55422100:-1 gene:ENSECAG00000008248 transcript:ENSECAT00000008337 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTQLPEAEKEKIAEQVADFKKVKSKLDAEIEIWDDTSNDIIVLAKKMCMIMMEMTDFTRG
KGPLKHTTEVIYAAKLISESGSRMDVLARQIANQCPDPSCKQDLLAYLEQIKFYSHQLKI
CSQVKAEIQNLGGELIMSALDSVTSLIQAAKNLMNAVVQTVKMSYIASTKIIRIQSPAGP
RHPVVMWRMKAPAKKPLIKREKPEESCAAVRRGSAKKKIHPVQVMSEFRGRHVY
Download sequence
Identical sequences F6TJV8
9796.ENSECAP00000006233 ENSECAP00000006233 ENSECAP00000006233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]