SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000006566 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000006566
Domain Number 1 Region: 506-718
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.94e-52
Family DBL homology domain (DH-domain) 0.00036
Further Details:      
 
Domain Number 2 Region: 189-333
Classification Level Classification E-value
Superfamily PH domain-like 1.2e-41
Family Third domain of FERM 0.00057
Further Details:      
 
Domain Number 3 Region: 702-826
Classification Level Classification E-value
Superfamily PH domain-like 5.65e-31
Family Pleckstrin-homology domain (PH domain) 0.0085
Further Details:      
 
Domain Number 4 Region: 852-994
Classification Level Classification E-value
Superfamily PH domain-like 2.95e-30
Family Pleckstrin-homology domain (PH domain) 0.002
Further Details:      
 
Domain Number 5 Region: 88-191
Classification Level Classification E-value
Superfamily Second domain of FERM 7.85e-28
Family Second domain of FERM 0.0000989
Further Details:      
 
Domain Number 6 Region: 7-88
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.61e-21
Family First domain of FERM 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000006566   Gene: ENSECAG00000008144   Transcript: ENSECAT00000008729
Sequence length 1000
Comment pep:known_by_projection chromosome:EquCab2:6:26701192:26795391:1 gene:ENSECAG00000008144 transcript:ENSECAT00000008729 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQEKHLHVRVKLLDNTVEIFDIEPKCDGQTLLTHVWRRLNLIECDYFGLEFQNSQSCWIW
LEPMKPIIRQVRRPKNAMLRLAVKFFPPDPGQLQEEYTRYLFALQLRRDLLEERLTCTDT
TAALLTSHLLQSEIGDYDEALDREHLKVNEYLPSQERSLEKILEFHRKHTGQTPAESDFQ
VLEIARKLEMYGIRFHTASDREGAKINLAVSHMGVLVFQSTTKINTFNWSRVRKLSFKRK
RFLVKLHPEVHGPYQDTLEFLLGSRDECKNFWKICVEYHTFFRLFDQPKPKAKAVFFSRG
SSFRYSGRTQKQLADYVKDGGMKRIPYERRHSKTRLSIRALTADLPRQKSVNVLIWAQFS
LQLSNGNFCQSPLSSLCFKGTNPSVWAAGQITVHASPAPLRSGTQTPQNPAGGSLPHLEE
RIGNDKSISSLPRLPPPASGHVGGLTSSAAPASPGGGKSAYVSIGVTLGPAEQGSSPLLS
PVLSNAGGARMDDEEEPKHKRFSADEAYFIAKEILATERTYLKDLEVITVWFRSAVVKED
AMPADLMTLLFSNIDPIYEFHRGFLHEVEQRLALWEGSSNAHATGGHQRIGDVLLRNMQQ
LKEFTSYFQRHDEVLTELEKATKRSKKLEMVYKEFELQKVCYLPLNTFLLKPIQRLVHYR
LLLSRLCGHYVPGHRDHADCRDALKAITEVTSTLQHSLVRLENLQKLTELQRDLVGIENL
ITPGREFIREGCLHKLTRKGLQQRMFFLFSDMLLYTSKGVSGTSHFRIRGLLPLRGMLVE
ESESEWSVPHCFTIYAAQKTMVVAASTRLEKEKWMHDLNTAIEAAKSGADAVPASLQSTC
PDRGSSDEVSLEQESEEDARSTHSSLEGQGQHRANTTVHVCWYRNTSVSRADHIAAVENQ
LSGYLLRKFKNSTGWQKLWVVFTNFCLFFYKTHQDDYPLASLPLLGYSVSVPRAADGIHK
EHVFKLQFKSHIYFFRAESKYTFGRWMEVIERASSSPGRP
Download sequence
Identical sequences F6VWS7
ENSECAP00000006566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]