SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000006604 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000006604
Domain Number 1 Region: 629-902
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 5.9e-100
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000579
Further Details:      
 
Domain Number 2 Region: 215-361
Classification Level Classification E-value
Superfamily PH domain-like 1.17e-34
Family Third domain of FERM 0.00017
Further Details:      
 
Domain Number 3 Region: 112-217
Classification Level Classification E-value
Superfamily Second domain of FERM 5.1e-33
Family Second domain of FERM 0.0002
Further Details:      
 
Domain Number 4 Region: 27-112
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.19e-20
Family First domain of FERM 0.0022
Further Details:      
 
Domain Number 5 Region: 508-597
Classification Level Classification E-value
Superfamily PDZ domain-like 9.99e-20
Family PDZ domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000006604   Gene: ENSECAG00000007806   Transcript: ENSECAT00000008774
Sequence length 913
Comment pep:known_by_projection chromosome:EquCab2:25:14711559:14783174:-1 gene:ENSECAG00000007806 transcript:ENSECAT00000008774 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSRLRALGGRINNIRTSELPKEKTRSEVICSICFLDGLVQTFKVNKQDTGQVLLDMVYN
HLGVTEKEYFGLQHGDDSVDSPRWLESSKPIRKQLKGGFPCTLHFRVRFFIPDPNTLQQE
QTRHLYFLQLKMDICEGRLTCPLNSAVVLASYAVQSHFGDYNSSIHHPGYLSDSQFIPDQ
SDDFVTKVESLHKQHSGLKQSEAESCYINIARTLDFYGVELHGGRDLHSLDLMIGIASSG
IAVYRKYICTSFYPWVNILKISFKRKKFFIHQRQKQTESREHIVAFNMLNYRSCKNLWKS
CVEHHSFFQAKKLLPQEKNVLSQYWTLGSRNSKKSVNNQCCKKVIGGMVWNPAMRRSLSV
EHLETKSLPSRSPPITPNWRSPRLRHEIRKPRHSSADNLANEMTYITETEDVFYTYKGSL
SPKDSDSEVSQNRSPHRKSVSENNPAHSCLTRKSSSSVSPSSNAPGSCSPDGVDQQFLED
FHRVTKGGSSEDSSQYYCDKNDNGDGYLVLIRITPDEDGKFGFNLKGGVDQKMPLVVSRI
NPESPADTCIPKLNEGDQIVLINGRDISEHTHDQVVMFIKASRESHTRELALVIRRKAVH
SFADIKSEDELNELFPEAIFPVCPEGGDTLEGSMEQLKKGLESGTVLIQFEQLYRKKPGL
AITFAKLPQNLDKNRYKDVLPYDTTRVLLQGNEDYINASSVNMEIPPAHLVNKYIATQGP
LPHTCAQFWQVIWDQKLSLIVMLTTLTERGRTKCHQYWPDPPDVMEYGSFHIRCQSEDCT
IAYVFREMLVTNTETGEEHTVTHLQYVAWPDHGVPDDPSDFLEFVNYVRSLRVDGEPVLV
HCSAGIGRTGVLVTMETAMCLIERNLPVYPLDIVRKMRDQRAMMVQTSSQYKFVCEAILR
VYEEGLVPMLDPS
Download sequence
Identical sequences F6UZV0
ENSECAP00000006604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]