SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000006616 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000006616
Domain Number 1 Region: 24-195
Classification Level Classification E-value
Superfamily Lipocalins 1.09e-37
Family Retinol binding protein-like 0.001
Further Details:      
 
Domain Number 2 Region: 226-283
Classification Level Classification E-value
Superfamily BPTI-like 1.7e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.00023
Further Details:      
 
Domain Number 3 Region: 286-338
Classification Level Classification E-value
Superfamily BPTI-like 6.39e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000006616   Gene: ENSECAG00000008365   Transcript: ENSECAT00000008789
Sequence length 352
Comment pep:known_by_projection chromosome:EquCab2:25:18881436:18894743:-1 gene:ENSECAG00000008365 transcript:ENSECAT00000008789 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSLGALLLLLTACLAVRASPVPTPPADIQVQENFDLSRIYGKWFLVAMGSTCPWLKKIK
DRMTISTLVLGEGATDGEISTTSTRWRKGVCEEISGTYEKTDTKGKFRYHKSKWNLSIES
YVVQTNYDEYAIFLSKKFSRRHGPTITAKLYGRDRQLRESLLDTFREVALGVGIPGDSIV
TLADRGECVPGEQEPEPMPFSRARRAVLPQEEEGSAAGQLTPEFSKKEDSCQLDHAEGPC
LGMISRYFYNGTSMACETFQYGGCLGNGNNFASEKECLQTCRTVAACNLPIVQGPCRAFI
RLWAFDAAQGKCVLFTYGGCRGNGNKFYSEKECKEYCGIPGDGDEELLRFSG
Download sequence
Identical sequences F6UZH0
9796.ENSECAP00000006616 XP_001488384.1.31192 XP_008523252.1.77740 ENSECAP00000006616 ENSECAP00000006616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]