SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000006714 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000006714
Domain Number 1 Region: 328-585
Classification Level Classification E-value
Superfamily p53-like transcription factors 2.24e-99
Family STAT DNA-binding domain 0.0000582
Further Details:      
 
Domain Number 2 Region: 137-333
Classification Level Classification E-value
Superfamily STAT 1.39e-54
Family STAT 0.00017
Further Details:      
 
Domain Number 3 Region: 2-125
Classification Level Classification E-value
Superfamily Transcription factor STAT-4 N-domain 2.35e-39
Family Transcription factor STAT-4 N-domain 0.00044
Further Details:      
 
Domain Number 4 Region: 586-708
Classification Level Classification E-value
Superfamily SH2 domain 8.35e-34
Family SH2 domain 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000006714   Gene: ENSECAG00000007847   Transcript: ENSECAT00000008906
Sequence length 788
Comment pep:known_by_projection chromosome:EquCab2:11:20704100:20726070:1 gene:ENSECAG00000007847 transcript:ENSECAT00000008906 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMAVWIQAQQLQGEALHQMQALYGQHFPIEVRHYLSQWIESQAWDSIDLDNPQENIKATQ
LLEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRL
VREASNGTSPAGSLADAMSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQES
LRIQAQFAQLAQLNPQERLSRETALQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQL
LRKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHL
CQQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGK
LNVHMNPPQVKATIISEQQAKSLLKNENTRNDYSGEILNNCCVMEYHQATGTLSAHFRNM
SLKRIKRSDRRGAESVTEEKFTILFESQFSVGGNELVFQVKTLSLPVVVIVHGSQDNNAT
ATVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFN
SSSSHLEDYNSMSVSWSQFNRENLPGRNYTFWQWFDGVMEVLKKHLKPHWNDGAILGFVN
KQQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSQERMFWNLMPFTTRDFSIRSLADR
LGDLNYLIYVFPDRPKDEVYSKYYTPVPCEPATAKAVDGYVKPQIKQVVPEFVSASADSA
GGSATYMDQAPSPAVCPQAHYNMYPQNPDPVLDTDGDFDLDDTMDVARRVEELLGRPMDS
QWIPHAQS
Download sequence
Identical sequences F6TGN6
ENSECAP00000006714 ENSECAP00000006714 9796.ENSECAP00000006714

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]