SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000006746 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000006746
Domain Number 1 Region: 54-221
Classification Level Classification E-value
Superfamily PR-1-like 2.75e-51
Family PR-1-like 0.00011
Further Details:      
 
Domain Number 2 Region: 289-387
Classification Level Classification E-value
Superfamily LCCL domain 8.24e-30
Family LCCL domain 0.0012
Further Details:      
 
Domain Number 3 Region: 391-490
Classification Level Classification E-value
Superfamily LCCL domain 2.09e-27
Family LCCL domain 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000006746   Gene: ENSECAG00000008400   Transcript: ENSECAT00000008944
Sequence length 498
Comment pep:known_by_projection chromosome:EquCab2:9:11693077:11738448:-1 gene:ENSECAG00000008400 transcript:ENSECAT00000008944 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKCTAREWLRVTTVLFMARAIPAMVVPNATLLEKLLEKYMDEDGEWWTAKQRGKRAITND
DMQSILDLHNKLRSQVYPTASNMEYMTWDVELERSAESWAENCLWEHGPSSLLPSIGQNL
GAHWGRYRPPTFHVQAWYDEVKDFSYPYEHECNPYCPFRCSGPVCTHYTQVVWATSSRIG
CAINLCHNMNIWGQIWPKAVYLVCNYSPKGNWWGHAPYKHGRPCSACPPSFGGGCRENLC
YKEGSDRYYTPQEEETNEIERQQSQVHDTHARAIADDSNRNEVISMQQMSQIVSCEVRLR
DQCKGTTCNRYECPAGCLDSKAKVIGSVHYEMQSSICRAAIHYGIIDNDGGWVDITRQGR
KHYFIKSKRNGVQTIGKYQSANSFTVSKVTVQAVTCETTVEQLCPFHKPASHCPRVYCPR
NCMQANPHYARVIGTRVYSDLSSICRAAVHAGVVQNQGGYVDIMPVDKRKTYTASFQNGI
FSESLQNPPGKGIQSICC
Download sequence
Identical sequences F6T9E4
9796.ENSECAP00000006746 ENSECAP00000006746 ENSECAP00000006746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]