SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000006957 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000006957
Domain Number 1 Region: 29-171
Classification Level Classification E-value
Superfamily C-type lectin-like 4.72e-34
Family C-type lectin domain 0.00000224
Further Details:      
 
Domain Number 2 Region: 308-382
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.28e-16
Family Complement control module/SCR domain 0.00083
Further Details:      
 
Domain Number 3 Region: 248-314
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 8.06e-16
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 4 Region: 372-445
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000195
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 5 Region: 186-251
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000208
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 6 Region: 429-496
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000236
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 7 Region: 494-555
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000347
Family Complement control module/SCR domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000006957   Gene: ENSECAG00000008423   Transcript: ENSECAT00000009181
Sequence length 617
Comment pep:known chromosome:EquCab2:5:6132283:6140251:-1 gene:ENSECAG00000008423 transcript:ENSECAT00000009181 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRTLEVMIASQFLSALTLVLLIKESGAWSYSASTTNMTFDEASAYCQQRYTHLVAIQNQ
EEIKYLNSIFNHSPSYYWIGIRKVNDKWVWIGTQKPLTEEAKNWAPGEPNNKQNEDCVEI
YIKRYKDAGKWNDENCNKKKLALCYTAACTHTSCSGHGECVETINNYTCQCHPGFTGLRC
EQVVTCQAQEAPEHGRLVCTHPLGNFSYNSSCSVSCEEGYLPSRTEAMQCTSSGEWSAPP
PACHVVECDALTNPANGVMQCSQSPGSFPWNTTCTFDCQEGFELTGPQHLQCTSSGNWDN
EKPTCKAVTCGAVGHPQNGFVNCSHSSAGEFTFNSSCNFTCEEGFVLQGPAQVECTAQGQ
WTQQVPVCKALQCKALSRPERGYMSCRPSTSGSFQSGSSCEFSCEQGFVLKGSKKLRCGP
TGEWDSEKPTCEAVRCDAVRQPQGGLVRCTHSAAGEFTYKSSCAFSCEEGFELRGSAQLE
CTLQGQWTQEVPSCQVVQCASLAVPGKVSMSCSGEPVFGAVCTFACPEGWTLNGSAALTC
GATGHWSGMLPTCEATAKSNIPLTVGLSAAGTSLLTLASFLFWLLKRLRRKAKKFVPASS
YQSLQSDGSYQMPSESA
Download sequence
Identical sequences F6QAA7
XP_005609620.1.31192 9796.ENSECAP00000006957 ENSECAP00000006957 ENSECAP00000006957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]