SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000007114 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000007114
Domain Number 1 Region: 267-528
Classification Level Classification E-value
Superfamily p53-like transcription factors 9.11e-81
Family STAT DNA-binding domain 0.00038
Further Details:      
 
Domain Number 2 Region: 529-648
Classification Level Classification E-value
Superfamily SH2 domain 4.71e-35
Family SH2 domain 0.00026
Further Details:      
 
Domain Number 3 Region: 1-115
Classification Level Classification E-value
Superfamily Transcription factor STAT-4 N-domain 1.96e-25
Family Transcription factor STAT-4 N-domain 0.0022
Further Details:      
 
Domain Number 4 Region: 112-273
Classification Level Classification E-value
Superfamily STAT 9.22e-25
Family STAT 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000007114   Gene: ENSECAG00000008705   Transcript: ENSECAT00000009359
Sequence length 847
Comment pep:known_by_projection chromosome:EquCab2:6:74759146:74769707:-1 gene:ENSECAG00000008705 transcript:ENSECAT00000009359 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVWGLVLKMPPEKLQRLYVDFPQHLRHLLGDWLENQPWEFLVGSDAFCCNMASALLSAT
LQHLQTLAGEQGEGSAILQHISTLESIYQRDPLKLVATFKHILQGERKAVMEQFHHLPMP
FHRKQEELKFNTVLRRLQHRVGETRLLREALKQGAEAGQVSLHSLIETPANGSGPSEALA
TLLQEAVAELEAAQALVLKRIQIWKRQQQLAGNGAPFEESLASLQERCESLVDIYSQLQQ
EVGAAGGELEPKTRAVLISRLEEVLRTLVTSSFLVEKQPPQVLKTQTKFQAGVRFLLGLR
FLGAPAKPPVVRADMVTEKQARELSMPQGPGAGTESSGEIINNTVPLENSIPGNCCSALF
KNLLLKKIKRCERKGTESVTEEKCAVLFSTSFALGPNKLHIQLQALSLPLVVIVHGNQDN
NAKATILWDNAFSEMDRVPFVVAERVPWEKMCETLNLKFMAEVGTNRGLLPEHFLFLAQK
IFNDNSLSTEAFQHRSVSWSQFNKEILLGRGFTFWQWFDGVLDLTKRCLRSYWSDRLIIG
FISKQYVTSLLLNEPDGTFLLRFSDSEIGGITIAHVIRGQDGSSQIENIQPFSAKDLSIR
SLGDRIRDLAQLKNLYPKKPKDEAFRSHYKPEQMGKDGRGYVPATIKMTVERDQPLPTPE
PQMPTMMPTYDLGMAPDSSMNMQLGPDMVPQVYPPHSHSMPSYQGLSREESVSVLPAFPE
PHLPMPPTLSQMSLPFDQPHPQGLLPCQPQEHAVSSPEPLLCSDVTMAEESCLSQPVGGF
PQGTWVSEDMFPPLLPPTEQDLTKLLLEGQGESGGGSLGAQPLLQPSPYGQSGISMSHLD
LRANPSW
Download sequence
Identical sequences F6WTW0
ENSECAP00000007114 9796.ENSECAP00000007114 ENSECAP00000007114 XP_005611384.1.31192 XP_014699456.1.49734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]