SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000007261 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000007261
Domain Number 1 Region: 1-229
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.53e-81
Family Eukaryotic proteases 0.00000217
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000007261   Gene: ENSECAG00000009203   Transcript: ENSECAT00000009524
Sequence length 230
Comment pep:known_by_projection chromosome:EquCab2:10:20444984:20447100:-1 gene:ENSECAG00000009203 transcript:ENSECAT00000009524 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RIIKGYECSPHSQPWQVALFQKTRLLCGATLIAPKWLLTAAHCRKPRYIVHLGEHNLQRQ
DGSEQTRTATESFPHPEFNYSLPNKDHRNDIMLVKMASPAMITWAVRPLTLSSRCVTPGT
QCLISGWGTTSSPQLHLPHTLRCANITIIEHKECEKAYPGDITDTMVCASVQEEGKDSCQ
GDSGGPLVCNGSLQGIISWGQDPCAVSRKPGVYTKVCKYVDWIQETMQNN
Download sequence
Identical sequences F6Y5Q6
9796.ENSECAP00000007261 ENSECAP00000007261 ENSECAP00000007261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]