SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000007393 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSECAP00000007393
Domain Number - Region: 113-153
Classification Level Classification E-value
Superfamily p53-like transcription factors 0.0597
Family Rel/Dorsal transcription factors, DNA-binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000007393   Gene: ENSECAG00000009324   Transcript: ENSECAT00000009672
Sequence length 254
Comment pep:known_by_projection chromosome:EquCab2:3:9451886:9482216:-1 gene:ENSECAG00000009324 transcript:ENSECAT00000009672 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGGDDGNLVIKKRFVSEAELDERRKRRQEEWEKVRKPEDPEECPEEAYDPRSLYERLQE
QKDRKQQEYEEQFKFKNMVRGLDEDETNFLDEVSRQQELIEKQRREEELKELKEYRISFN
HVGISSENKKEVEKKVAVKPMETRNKFSQAKLLAGAVKHKSSESGNSVKRLKSDPDPDDK
NQEALPCVSLGSASLSAPSIHCPSAAVCIGILPGLGAYSGSSDSESSSDSEGTINATGKI
VSSIFRTNTFLEAP
Download sequence
Identical sequences F6WS27
ENSECAP00000007393 ENSECAP00000007393 9796.ENSECAP00000007393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]