SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000007439 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000007439
Domain Number 1 Region: 2-273
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 5.34e-61
Family Pancreatic carboxypeptidases 0.000000952
Further Details:      
 
Domain Number 2 Region: 273-369
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 4.32e-22
Family Carboxypeptidase regulatory domain 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000007439   Gene: ENSECAG00000009256   Transcript: ENSECAT00000009727
Sequence length 374
Comment pep:known_by_projection chromosome:EquCab2:2:69289564:69318502:-1 gene:ENSECAG00000009256 transcript:ENSECAT00000009727 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GEPEFKYIGNMHGNEAVGRELLIFLAQYLCNEYQKGNETIVKLIHNTRIHIMPSLNPDGF
EKAASQPGELKDWFVGRSNAQGIDLNRNFPDLDRIVYANEKEGGPNNHLLKNLKKIVDQN
TKLAPETKAVIHWIMDIPFVLSANLHGGDLVANYPYDETRSGSAHEYSSCPDDAIFQSLA
RAYSSFNPPMSDPNRPPCRKNDDDSSFVDGTTNGAAWYSVPGGMQDFNYLSSNCFEITVE
LSCEKFPPEETLKSYWEDNKDSLISYLEQIHRGVKGFVRDLQGNPIANATISVEGIDHDI
TSAKDGDYWRLLVPGNYKLTASAPGYLAITKKVAVPYSPAVGVDFELESFSERKEEEKEE
LMEWWKMMSETLNF
Download sequence
Identical sequences F6YQD9
ENSECAP00000007439 ENSECAP00000007439 9796.ENSECAP00000007439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]