SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000007853 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000007853
Domain Number 1 Region: 317-568
Classification Level Classification E-value
Superfamily p53-like transcription factors 2.07e-109
Family STAT DNA-binding domain 0.000000000299
Further Details:      
 
Domain Number 2 Region: 134-317
Classification Level Classification E-value
Superfamily STAT 3.53e-65
Family STAT 0.0000000149
Further Details:      
 
Domain Number 3 Region: 1-121
Classification Level Classification E-value
Superfamily Transcription factor STAT-4 N-domain 1.7e-44
Family Transcription factor STAT-4 N-domain 0.0000193
Further Details:      
 
Domain Number 4 Region: 569-710
Classification Level Classification E-value
Superfamily SH2 domain 3.1e-44
Family SH2 domain 0.00000012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000007853   Gene: ENSECAG00000009039   Transcript: ENSECAT00000010206
Sequence length 749
Comment pep:known_by_projection chromosome:EquCab2:18:67304567:67338242:-1 gene:ENSECAG00000009039 transcript:ENSECAT00000010206 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQWYELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAANDVSFATIRFHDL
LSQLDDQYSRFSLENNFLLQHNIRKSKRNLQDNFQEDPIQMSMIICSCLKEERKILENAQ
RFNQAQSGNIQSTVMLDKQKELDSRVRNVKDKVMCIEQEIKTLEDLQDEYDFKCKTSQNR
EHEANGVAKNDQKQEQMLLQKMYLMLDNKRKEVVHKIIELLNVTELTQKALINDELVEWK
RRQQSACIGGPPNACLDQLQNWFTIVAESLQQVRQQLKKLEELEQKYTYEHDPITKNKQG
LWDRTFSLFQQLIQNSFVVERQPCMPTHPQRPLVLKTGVQFTVKLRLLVKLQELNYNLKV
KVLFDKDVNERNTVKGFRKFNILGTHTKVMNMEESTNGSLAAEFRHLQLKEQKNAGTRTN
EGPLIVTEELHSLSFETQLCQPGLVIDLETTSLPVVVISNVSQLPSGWASILWYNMLVAE
PRNLSFFLNPPCARWSQLSEVLSWQFSSVTKRGLSVDQLNMLGEKLLGPNAGPDGLIPWT
RFCKENINDKNFPFWLWIESILELIKKHLLSLWNDGCIVGFISKERERALLKDQQPGTFL
LRFSESCREGAITFTWVERSQNGGEPYFHAVEPYTKKELSAVTFPDIIRNYKVMAAENIP
ENPLKYLYPNIDKDHAFGKYYSRPKEAPEPMELDGPKGTGYIKTELISVSEVHPSRLQTT
DNLLPMSPEEFDEVSRIVGSVEFDMVSTW
Download sequence
Identical sequences F6ZBH0
ENSECAP00000007853 ENSECAP00000007853 9796.ENSECAP00000007853

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]