SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000008010 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000008010
Domain Number 1 Region: 347-550
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.3e-57
Family Nucleotide and nucleoside kinases 0.0000161
Further Details:      
 
Domain Number 2 Region: 200-337
Classification Level Classification E-value
Superfamily SH3-domain 2.89e-34
Family SH3-domain 0.0011
Further Details:      
 
Domain Number 3 Region: 122-210
Classification Level Classification E-value
Superfamily PDZ domain-like 1.09e-16
Family PDZ domain 0.00056
Further Details:      
 
Domain Number 4 Region: 54-108
Classification Level Classification E-value
Superfamily L27 domain 0.0000000000001
Family L27 domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000008010   Gene: ENSECAG00000009638   Transcript: ENSECAT00000010388
Sequence length 554
Comment pep:known_by_projection chromosome:EquCab2:4:56006649:56065543:1 gene:ENSECAG00000009638 transcript:ENSECAT00000010388 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQQVLDNLTELPSSTGAEEIDLIFLKGIMENPIVKSLAKAHERLEDSKLEAVSDNNLELV
NEILEDITPLINVDENVAELVGILKEPHFQSLLEAHDIVASKCYDSPPSSPEMNNSSINN
QLLPVDAIRILGIHKRAGEPLGVTFRVENNDLVIARILHGGMIDRQGLLHVGDIIKEVNG
HEVGNNPKELQELLKNISGSVTLKILPSYRDTITPQQSCISMERHPAHARQVFVKCHFDY
NPYNDNLIPCKEAGLKFSKGEILQIVNREDPNWWQASHVKEGGSAGLIPSQFLEEKRKAF
VRRDWDNSGPFCGTISSKKKKKMMYLTTRNAEFDRHEIQIYEEVAKMPPFQRKTLVLIGA
QGVGRRSLKNRFIVLNPTRFGTTVPFTSRKPREDEKDGQAYKFVSRSEMEADIKAGKYLE
HGEYEGNLYGTKIDSILEVVQTGRTCILDVNPQALKVLRTSEFMPYVVFIAAPELETLRA
MHKAVVDAGITTKLLTDSDLKKTVDESARIQRAYNHYFDLIIVNDNLDKAFEKLQTATEK
LRTEPQWVPISWVY
Download sequence
Identical sequences F6RN93
9796.ENSECAP00000008010 XP_014594591.1.31192 XP_014694497.1.49734 XP_014694498.1.49734 XP_014694499.1.49734 ENSECAP00000008010 ENSECAP00000008010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]