SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000008138 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000008138
Domain Number 1 Region: 162-413,473-546
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.22e-60
Family L-arabinose binding protein-like 0.0017
Further Details:      
 
Domain Number 2 Region: 74-130
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000208
Family Complement control module/SCR domain 0.0000354
Further Details:      
 
Domain Number 3 Region: 27-74
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000375
Family Complement control module/SCR domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000008138   Gene: ENSECAG00000009175   Transcript: ENSECAT00000010531
Sequence length 959
Comment pep:known_by_projection chromosome:EquCab2:20:28737655:28763500:-1 gene:ENSECAG00000009175 transcript:ENSECAT00000010531 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GCQIIHPPWEGGIRYRGLTRDQVKAINFLPVDYEIEYVCRGEREVVGPKVRKCLANGSWT
DMDTPSRCVRICSKSYLTLENGKVFLTGGDLPALDGARVDFRCDPDFHLVGSSRSICSQG
QWSTPKPHCQVNRTPHSGESAVRGALRELELGGWPGQACQPVEMALEDVNSRRDILPDYE
LKLHHDSKGCDPGQATKYLYELLYNDPIKIILMPGCSSVSTLVAEAARMWNLIVLSYGSS
SPALSNRQRFPTFFRTHPSATLHNPTRVKLFEKWGWKKIATIQQTTEVFTSTLDDLEERV
KEAGIEITFRQSFFSDPAVPVKNLKRQDARIIVGLFYETEARKVFCEVYKERLFGKKYVW
FLIGWYADNWFKIYDPSINCTVDEMTEAVEGHITTEIVMLNPANTRSISNMVRVQDFPEG
RSTRVGPRAQSRGDLEKKQSGLHSVRKALSLDQWSGGGRGLGIYISNNLKDERTSTLQLF
IGISISLFVGVSGHVVFDASGSRMAWTLIEQLQGGSYKKIGYYDSTKDDLSWSKTDKWIG
GSPPADQTLVIKTFRFLSQKLFISVSVLSSLGIVLAVVCLSFNIYNSHVRYIQNSQPNLN
NLTAVGCSLALAAVFPLGLDGYHIGRNQFPFVCQARLWLLGLGFSLGYGSMFTKIWWVHT
VFTKKEEKKEWRKTLEPWKLYATVGLLVGMDVLTLAIWQIVDPLHRTIETFAKEEPKEDI
DVSILPQLEHCSSRKMNTWLGGLWKKRQRANVNTRGWIGEEAPFLLWSCIFYGYKGLLLL
LGIFLAYETKSVSTEKINDHRAVGMAIYNVAVLCLITAPVTMILSSQQDAAFAFASLAIV
FSSYITLVVLFVPKMRRLITRGEWQSEAQDTMKTGSSTNNNEEEKSRLLEKENRELEKII
AEKEERVSELRHQLQSRQQLRSRRHPPTPPDPSGGLPRGPAEPPDRLSCDGSRVHLLYK
Download sequence
Identical sequences F6PYU4
ENSECAP00000008138 9796.ENSECAP00000008138 ENSECAP00000008138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]