SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000008152 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000008152
Domain Number 1 Region: 41-222
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.03e-75
Family T-box 0.0000000275
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000008152   Gene: ENSECAG00000010186   Transcript: ENSECAT00000010547
Sequence length 445
Comment pep:known_by_projection chromosome:EquCab2:5:4796430:4822676:1 gene:ENSECAG00000010186 transcript:ENSECAT00000010547 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMSELSTQKTSDGTVSRLLNVVESELQAGREKGDPTEKQLQIILEDAPLWQRFKEVTNE
MIVTKNGRRMFPVLKISVTGLDPNAMYSLLLDFVPTDSHRWKYVNGEWVPAGKPEVSSHS
CVYIHPDSPNFGAHWMKAPISFSKVKLTNKLNGGGQIMLNSLHKYEPQVHIVRVGGAHRM
VTNCSFPETQFIAVTAYQNEEITALKIKYNPFAKAFLDAKERNHLKDVPEAVAESQHVAY
SHLGGWIFSNPDGVCTAGNANYQYATPLPLSAPHTHQGCEHYPGLRGHRQAPYPSAYMHR
NHSPSVNLIESSSNNLQVFSGADSWTSLSSTPHASILSVPHTSGPMNPGPSPYPCLWTIS
NSGAGPAGPGTEVHAGSPGAFLLGNPAVTSPLSTQAPTSAGVEVLGEPSLTSIAVSTWTA
VASHPFSGWGGPGGGGLHSPSSLDS
Download sequence
Identical sequences F6PR95
ENSECAP00000008152 XP_001494328.1.31192 9796.ENSECAP00000008152 ENSECAP00000008152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]