SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000008175 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000008175
Domain Number 1 Region: 100-351,411-484
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 9.66e-61
Family L-arabinose binding protein-like 0.0017
Further Details:      
 
Domain Number 2 Region: 29-68
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000639
Family Complement control module/SCR domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000008175   Gene: ENSECAG00000009175   Transcript: ENSECAT00000010576
Sequence length 869
Comment pep:known_by_projection chromosome:EquCab2:20:28737655:28763500:-1 gene:ENSECAG00000009175 transcript:ENSECAT00000010576 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GCQIIHPPWEGGIRYRGLTRDQVKAINFLPVDYEIEYVCRGEREVVGPKVRKCLANGSWT
DMDTPSRCVNRTPHSGESAVRGALRELELGGWPGQACQPVEMALEDVNSRRDILPDYELK
LHHDSKGCDPGQATKYLYELLYNDPIKIILMPGCSSVSTLVAEAARMWNLIVLSYGSSSP
ALSNRQRFPTFFRTHPSATLHNPTRVKLFEKWGWKKIATIQQTTEVFTSTLDDLEERVKE
AGIEITFRQSFFSDPAVPVKNLKRQDARIIVGLFYETEARKVFCEVYKERLFGKKYVWFL
IGWYADNWFKIYDPSINCTVDEMTEAVEGHITTEIVMLNPANTRSISNMVRVQDFPEGRS
TRVGPRAQSRGDLEKKQSGLHSVRKALSLDQWSGGGRGLGIYISNNLKDERTSTLQLFIG
ISISLFVGVSGHVVFDASGSRMAWTLIEQLQGGSYKKIGYYDSTKDDLSWSKTDKWIGGS
PPADQTLVIKTFRFLSQKLFISVSVLSSLGIVLAVVCLSFNIYNSHVRYIQNSQPNLNNL
TAVGCSLALAAVFPLGLDGYHIGRNQFPFVCQARLWLLGLGFSLGYGSMFTKIWWVHTVF
TKKEEKKEWRKTLEPWKLYATVGLLVGMDVLTLAIWQIVDPLHRTIETFAKEEPKEDIDV
SILPQLEHCSSRKMNTWLGIFYGYKGLLLLLGIFLAYETKSVSTEKINDHRAVGMAIYNV
AVLCLITAPVTMILSSQQDAAFAFASLAIVFSSYITLVVLFVPKMRRLITRGEWQSEAQD
TMKTGSSTNNNEEEKSRLLEKENRELEKIIAEKEERVSELRHQLQSRQQLRSRRHPPTPP
DPSGGLPRGPAEPPDRLSCDGSRVHLLYK
Download sequence
Identical sequences F6PPV0
ENSECAP00000008175

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]