SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000008667 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000008667
Domain Number 1 Region: 113-188
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.000000133
Family Rhamnogalacturonase B, RhgB, middle domain 0.017
Further Details:      
 
Domain Number 2 Region: 947-1036
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00000051
Family Carboxypeptidase regulatory domain 0.025
Further Details:      
 
Domain Number 3 Region: 866-937
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.00000922
Family Rhamnogalacturonase B, RhgB, middle domain 0.037
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000008667
Domain Number - Region: 793-852
Classification Level Classification E-value
Superfamily Cna protein B-type domain 0.00392
Family Cna protein B-type domain 0.0094
Further Details:      
 
Domain Number - Region: 201-285
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.00432
Family Rhamnogalacturonase B, RhgB, middle domain 0.023
Further Details:      
 
Domain Number - Region: 37-101
Classification Level Classification E-value
Superfamily Cna protein B-type domain 0.00785
Family Cna protein B-type domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000008667   Gene: ENSECAG00000010013   Transcript: ENSECAT00000011129
Sequence length 1205
Comment pep:known chromosome:EquCab2:13:29562390:29611787:-1 gene:ENSECAG00000010013 transcript:ENSECAT00000011129 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AVVLLLLLLSGVHPARGSEDIVVGCGGFVKSDVEINYSLIEIKLYTKHGTLKYQTDCAPN
NGYFMIPLYDKGDFILKIEPPLGWSFEPTTVELHVDGVSDICTKGGDVNFVFTGFSVNGK
VLSKGQPLGPAGVQVSLRSTGTDAKIQSTVTQPGGKFAFFKVLPGDYEILATHPTWALKE
ASTTVRVTNSNANAASPLVVAGYNVSGSVRSDGEPMKGVKFLLFSSSVAKEDVLGCNISP
VPGFQPQDESLVYLCYAVSKEDGSFSFYSLPSGGYTVVPFYRGERITFDVAPSRLDFTVE
HDSLKIELAFRRMGAGEWGRMFPDGEQIREAAVTIFSKPDLMVKMLKPQRGKEIQLGTNK
VAARKEDVRTEMPPFRLQPRPPAGLNGPFHRFSVCGQIAILRFPDSAKQMSKYRVVLSSQ
EKDKALVNVEDAQGSFCFKAKPGTYKVQVVVPEAETRAGLTLKPQTFPLEVTDRPVLNVA
FVQFLASVSGKVSCLDSCGDLLVTLQSLSRQGEKRSLQLSGKVNSMTFTFDNVLPGKYKI
SMMHEDWCWKNKSLEVEVLEDDVSAVEFRQTGYMLRCSLSHAITLEFYQDGNGPENVGIY
NLSKGVNRFCLSKPGVYKVTPRSCHRFEQAFYTYDTSSPSILTLTAIRHHVLGTITTDKM
MDVTVTIKSSIDSEPALVLGPLKSVQELRREQQLAEIESRRQEREKSGKEEAGAEGTKPP
IQEMVDELQGPFSYDFSYWARSGEKITVTPSSKELLFYPPSMEATVSGESCPGKLIEIHG
KAGLFLEGQIHPELEGVEIVISEKGASSPLITVFTDDKGAYSVGPLHSDLEYTVSSQKEG
YVLTAVEGTVGDFKAYALAGVSFEIKAEDDQPLPGVLLSLSGGVFRSNLLTQDNGILTFS
NLSPGQYYFKPMMKEFRFEPSSQMIEVEEGQNLRIAITGYRTAYSCYGTVSSLNGEPEQG
VAVEAVGQSDCSIYGEDTVTDEEGKFRLRGLLPGCVYHVQLKAEGNDHIERALPHHRVIA
VGNNDIDDVNIIVFRQINQFDLSGNVITSSEYLPTLWVKLYKSENLDNPIQTVSLGQSVF
FHFPPLLRDGQNYVVLLDSTLPRSQYEYVLPQVSFTALGYHKHITLVFSPTRKLPEQDVA
QGSYIALPLTLLVLLAGYNHDKLIPLLLQLTSRLQGVRGLGQTASDSSGPEDAKRQAKKQ
KTRRT
Download sequence
Identical sequences F6PLC2
ENSECAP00000008667 ENSECAP00000008667 9796.ENSECAP00000008667

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]