SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000008746 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000008746
Domain Number 1 Region: 109-184
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.000000133
Family Rhamnogalacturonase B, RhgB, middle domain 0.017
Further Details:      
 
Domain Number 2 Region: 945-1034
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00000051
Family Carboxypeptidase regulatory domain 0.025
Further Details:      
 
Domain Number 3 Region: 864-935
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.00000922
Family Rhamnogalacturonase B, RhgB, middle domain 0.037
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000008746
Domain Number - Region: 791-850
Classification Level Classification E-value
Superfamily Cna protein B-type domain 0.00392
Family Cna protein B-type domain 0.0094
Further Details:      
 
Domain Number - Region: 197-281
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.00432
Family Rhamnogalacturonase B, RhgB, middle domain 0.023
Further Details:      
 
Domain Number - Region: 33-97
Classification Level Classification E-value
Superfamily Cna protein B-type domain 0.00785
Family Cna protein B-type domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000008746   Gene: ENSECAG00000010013   Transcript: ENSECAT00000011217
Sequence length 1203
Comment pep:known chromosome:EquCab2:13:29562390:29611775:-1 gene:ENSECAG00000010013 transcript:ENSECAT00000011217 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLLLLSGVHPARGSEDIVVGCGGFVKSDVEINYSLIEIKLYTKHGTLKYQTDCAPNNGYF
MIPLYDKGDFILKIEPPLGWSFEPTTVELHVDGVSDICTKGGDVNFVFTGFSVNGKVLSK
GQPLGPAGVQVSLRSTGTDAKIQSTVTQPGGKFAFFKVLPGDYEILATHPTWALKEASTT
VRVTNSNANAASPLVVAGYNVSGSVRSDGEPMKGVKFLLFSSSVAKEDVLGCNISPVPGF
QPQDESLVYLCYAVSKEDGSFSFYSLPSGGYTVVPFYRGERITFDVAPSRLDFTVEHDSL
KIEEHIFGEANWLVRRVVTGGAGAGAPGTGRTVNHTDIVKTRLDGSLRGKEIQLGTNKVA
ARKEDVRTEMPPFRLQPRPPAGLNGPFHRFSVCGQIAILRFPDSAKQMSKYRVVLSSQEK
DKALVNVEDAQGSFCFKAKPGTYKVQVVVPEAETRAGLTLKPQTFPLEVTDRPVLNVAFV
QFLASVSGKVSCLDSCGDLLVTLQSLSRQGEKRSLQLSGKVNSMTFTFDNVLPGKYKISM
MHEDWCWKNKSLEVEVLEDDVSAVEFRQTGYMLRCSLSHAITLEFYQDGNGPENVGIYNL
SKGVNRFCLSKPGVYKVTPRSCHRFEQAFYTYDTSSPSILTLTAIRHHVLGTITTDKMMD
VTVTIKSSIDSEPALVLGPLKSVQELRREQQLAEIESRRQEREKSGKEEAGAEGTKPPIQ
EMVDELQGPFSYDFSYWARSGEKITVTPSSKELLFYPPSMEATVSGESCPGKLIEIHGKA
GLFLEGQIHPELEGVEIVISEKGASSPLITVFTDDKGAYSVGPLHSDLEYTVSSQKEGYV
LTAVEGTVGDFKAYALAGVSFEIKAEDDQPLPGVLLSLSGGVFRSNLLTQDNGILTFSNL
SPGQYYFKPMMKEFRFEPSSQMIEVEEGQNLRIAITGYRTAYSCYGTVSSLNGEPEQGVA
VEAVGQSDCSIYGEDTVTDEEGKFRLRGLLPGCVYHVQLKAEGNDHIERALPHHRVIAVG
NNDIDDVNIIVFRQINQFDLSGNVITSSEYLPTLWVKLYKSENLDNPIQTVSLGQSVFFH
FPPLLRDGQNYVVLLDSTLPRSQYEYVLPQVSFTALGYHKHITLVFSPTRKLPEQDVAQG
SYIALPLTLLVLLAGYNHDKLIPLLLQLTSRLQGVRGLGQTASDSSGPEDAKRQAKKQKT
RRT
Download sequence
Identical sequences F7DQD3
ENSECAP00000008746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]