SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000008894 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000008894
Domain Number 1 Region: 76-254
Classification Level Classification E-value
Superfamily PR-1-like 2.62e-44
Family PR-1-like 0.0000244
Further Details:      
 
Domain Number 2 Region: 255-310
Classification Level Classification E-value
Superfamily Crisp domain-like 0.00000000000000152
Family Crisp domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000008894   Gene: ENSECAG00000011049   Transcript: ENSECAT00000011384
Sequence length 311
Comment pep:known chromosome:EquCab2:20:47841108:47871684:-1 gene:ENSECAG00000011049 transcript:ENSECAT00000011384 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLCPLPAVNSWMSCKHFPCTDFFIEQIFPVGGCCEALAHYLAKDLGLIGTLNFTNCVNL
EMTMKHFLFLAAAAAGFLPVVIIRAKPASVPYHTLLTELATVQEEIVTVHNTLRRGVVPP
ASNMLKMNWSEEAAQNARRLSAQCELIESKAVERRITNTFCGENMHLTSYPISWSNVIGI
WFSESKYFKYGQWISTDDEVIIEHYTQLVWATSYLIGCGISSCSKRRSTQYLYVCHYCHE
GNDPDKKNVPYNMGTPCKDCPNDCEDRLCTNPCLYYDESNKCKTQKEALGCSHLSVKLFC
KATCLCDTEIK
Download sequence
Identical sequences F7CZU9
XP_005603549.1.31192 XP_008504842.1.77740 9796.ENSECAP00000008894 ENSECAP00000008894 ENSECAP00000008894

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]