SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000009236 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000009236
Domain Number 1 Region: 90-280
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.04e-50
Family Astacin 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000009236   Gene: ENSECAG00000011307   Transcript: ENSECAT00000011774
Sequence length 429
Comment pep:known_by_projection chromosome:EquCab2:15:12316682:12330734:1 gene:ENSECAG00000011307 transcript:ENSECAT00000011774 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGHMGGLWPWVLGLLSVPGLILGAPSASSCPGACEPSFSEGLAPEATQTSWDKDIPAINQ
GLIPEETPESSFLLEGDILRPSPFRLLSASSNKWPKNDGVVEVPFLLSSKYDQPSREVIL
EAFAEFERFTCIRFVAYQGQRDFISIIPMSGCFSGVGRSGGMQVVSLAPTCLQRGRGIVL
HELMHVLGFWHEHARADRDRYIRVNWNEILPGFEINFIKSPNSNMLVPYDYSSVMHYGRL
AFSRRGLPTITPLWASSVHIGQRWNLSTSDITRVLRLYDCSPSGPDPRGRGFQAHSSGRS
PTPASRPHLQRFLKALLAESSGSRAGGQRVAAGPGESLHGLEPPALRNFGVEASARPPQT
PASSPRSRPGAGAPGIAPERSWQGQVPTVPPAPSLEAEDQPAPIQAALGKPSQPGARVPG
SHIRGTPRG
Download sequence
Identical sequences F7ALI3
9796.ENSECAP00000009236 ENSECAP00000009236 ENSECAP00000009236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]