SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000009392 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000009392
Domain Number 1 Region: 1052-1247
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.49e-58
Family BCR-homology GTPase activation domain (BH-domain) 0.0000244
Further Details:      
 
Domain Number 2 Region: 842-965
Classification Level Classification E-value
Superfamily PH domain-like 7.95e-32
Family Pleckstrin-homology domain (PH domain) 0.000000537
Further Details:      
 
Domain Number 3 Region: 11-71
Classification Level Classification E-value
Superfamily PDZ domain-like 1.09e-16
Family PDZ domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000009392   Gene: ENSECAG00000011309   Transcript: ENSECAT00000011957
Sequence length 1866
Comment pep:known_by_projection chromosome:EquCab2:29:11913067:12003218:1 gene:ENSECAG00000011309 transcript:ENSECAT00000011957 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GKQRNRLEPMDTIFVKQVKEGGPAFEAGLCTGDRIIKVNGESVIGKTYSQVIALIQNSDT
TLELSVMPKDEDILQVLQFTKDVTALAYSQDAYLKGNEAYSGNARNIPEPPPLCYPWLPS
APSAMAQPVEISPPDSSSSKQQTSTPVLTQPGRAYRMEIQVPPSPTDVAKSNTAVCVCNE
SVRTVIVPSEKVVDLLTSRNNHTVPSHRTEEVRYGLSEQTSLKTVSRTTSPSSSIPTAHL
IHQTTGPRSLEASGILLKSGNYSGHSEGISSNRSQAVDSPSASVNHYSPNSHQHIDWKNY
KTYKEYIDNRRLHIGCRTIQERLDSLRAASQGTADYNQVVPNRTTLQVRRRSTSHDRVPQ
SVQIRQRSVSQERLEDSVLMKYCPRSASQGALTSPSVSFSNHRTRSWDYIEGQGESLENN
SESQIPDSNGERKQTYKWSGFTEQDDRRGIYERPRQQEIHKSFRGSNFTVAPSIVNSDNR
RMSGRGVGAQFKKIPSDLKTTQSNRNFQTTCGMSLPRGVSQDRSPLVKVRSNSLKAPSTH
VTKPSFSQNSFVSIKDQRPINHLHQNSLLNQQTWLRTESAPDHQVETGKPPTSSGASVTP
APQLSENSGTSDLELPVTQSNQDSNLQEAEIQQSNTLDNKETVVLREKPPSGRQTPQPLR
HQSYILAVNDQDTGSDTTCWLPNDARREVHIKRMEERKASSTSPPGDSLASIPFIDEPTS
PSIDHDIAHIPASAVISASASQAPSIATVPPSLTTSAPLIRRQLSHDQESGGPASLDAQP
SSKTERSKSYDEGLDDYREDAKLSFKHVSSLKGIKITDSQKSSEDSGSRKDSSSEVFSDA
AKEGWLHFRPLVTDKGKRVGGSIRPWKQMYVVLRGHSLYLYKDKREQMTPSEEEQPISVN
ACLIDISYSETKRKNVFRLTTSDCECLFQAEDRDDMLAWIKTIQESSTLNEEDTGVTNRD
LISRRIKEYNSLMSKAEQLPKTPRQTLSIRQTLLGAKSEPKTQSPHSPKEESERKLLSKD
DTSPPKDKGTWRKGIPSIMRKTFEKKPTATGTFGVRLDDCPPAHTNRYIPLIVDICCKLV
EERGLEYTGIYRVPGNNAAISSMQEELNKGMADIDIQDDKWRDLNVISSLLKSFFRKLPE
PLFTNEKYADFIEANRKEDPLERLKTLKRLIHDLPEHHYETLKFLSAHLKTVAENSEKNK
MEPRNLAIVFGPTLVRTSEDNMTHMVTHMPDQYKIVETLIQHHDWFFTEEGAEEPLTTVQ
EENTVDCQPVPNIDHLLTNIGRTGVSPGDVSDSAASDSAKSKGSWGSGKDQYSRELLVSS
IFAAASRKRKKPKEKAQPSSSEDELDSVFSKKESAEYCHSETKEESKKESETWGRKQRII
ISKENSAKKDISATKDEKMSLPKESMPSEEPSPPHNSKYNKSPTLSCRFTILKESPRSPG
TQKSSQFEETGSDSGTLLSTSSQASLARHSTKKSTSPETKHSEFLANVSTITSDYSTTSS
TTYLTSLDSSRLSPEVQSVAESKGDEADDERSELVSEGRPVETDSENDFPVFPTALTSEK
LFRGKPQEVTKTSRRNSEGSEVSCTEGSLTPSLDSRRQHFSSHKLIECDTLSRKKSARFK
SDSGSLGDAKNEKDTPSITKVFDVMKKGKSTGSLLTPTRSEPEKQEPTWKTKIADRLKLR
PRAPADDMFGVGNQKTSAETAKRKNIKRRHTLGGHRDAAEISVLTFWKAQEQSGERESEL
SAVNRLKPKCSAQDLSISDWLARERLRTSASDLSRGETGDPQPGNSSTLEIAMTDPPLSF
QSDAGSSPGTLASTNRPLLCTPPQSPDQINGESFQNVSQNASSAANAQPHKLSETPGNKA
QFRPCL
Download sequence
Identical sequences F6ZL11
9796.ENSECAP00000009392 ENSECAP00000009392 ENSECAP00000009392

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]