SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000009607 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000009607
Domain Number 1 Region: 2-187
Classification Level Classification E-value
Superfamily YWTD domain 1.15e-28
Family YWTD domain 0.00017
Further Details:      
 
Domain Number 2 Region: 278-319
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000249
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 3 Region: 319-358
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000038
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 4 Region: 413-449
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000602
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 5 Region: 373-408
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000209
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 6 Region: 243-280
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000209
Family LDL receptor-like module 0.0017
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000009607
Domain Number - Region: 197-258
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0251
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000009607   Gene: ENSECAG00000011793   Transcript: ENSECAT00000012187
Sequence length 449
Comment pep:novel chromosome:EquCab2:18:23783227:23855111:-1 gene:ENSECAG00000011793 transcript:ENSECAT00000012187 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VGSVEGLAYHRAWDTLYWTSSTTSSITRHTVDQTRPGAFDREAVIAMSEDDHPHVLALDE
CQNLMFWTNWNEQHPSIMRATLTGKNAQMVVSTDILTPNGLTIDHRAEKLYFSDGSLGKI
ERCEYDGSQRHVIVKSGPGTFLSLAVYDNYIFWSDWGRRAILRSNKYTGGDTKILRSDIP
HQPMGIIAVANDTNSCELSPCALLNGGCHDLCLLTPNGRVNCSCRGDRILLDDNRCVAKN
SSCNIYSEFECGNGECIDYQLTCDGIPHCKDKSDEKLLYCENRSCRRGFKPCYNHRCIPH
DKLCDGENDCGDNSDELDCKVSTCAAVEFRCADGTCIPRSARCNQNIDCADASDEKNCNN
TDCTHFYKLGVKTTGFIKCNSTSLCVLPTWICDGSNDCGDYSDELKCPVQNKHKCEENYF
GCPSGRCILNTWICDGQKDCEDGLDEFHC
Download sequence
Identical sequences F7A1R3
ENSECAP00000009607 ENSECAP00000009607 9796.ENSECAP00000009607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]