SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000009652 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000009652
Domain Number 1 Region: 908-969
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.24e-18
Family Complement control module/SCR domain 0.0051
Further Details:      
 
Domain Number 2 Region: 850-909
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000144
Family Complement control module/SCR domain 0.00076
Further Details:      
 
Domain Number 3 Region: 666-727
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000236
Family Complement control module/SCR domain 0.00015
Further Details:      
 
Domain Number 4 Region: 363-421
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000236
Family Complement control module/SCR domain 0.00091
Further Details:      
 
Domain Number 5 Region: 783-844
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000839
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 6 Region: 426-480
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000983
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 7 Region: 724-787
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000297
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 8 Region: 602-682
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000367
Family Complement control module/SCR domain 0.00012
Further Details:      
 
Domain Number 9 Region: 543-598
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000262
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 10 Region: 5-66
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000288
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 11 Region: 299-360
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000288
Family Complement control module/SCR domain 0.0039
Further Details:      
 
Domain Number 12 Region: 191-248
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000102
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 13 Region: 244-308
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000668
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 14 Region: 124-181
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000197
Family Complement control module/SCR domain 0.0029
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000009652
Domain Number - Region: 489-553
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000364
Family Complement control module/SCR domain 0.0051
Further Details:      
 
Domain Number - Region: 55-121
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00058
Family Complement control module/SCR domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000009652   Gene: ENSECAG00000011534   Transcript: ENSECAT00000012237
Sequence length 970
Comment pep:novel chromosome:EquCab2:30:24781672:24835951:-1 gene:ENSECAG00000011534 transcript:ENSECAT00000012237 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ETTCDPPYIPNGVYTPERTEHRIEQEIRYKCKNGFHPATRGNTAKCTSSGWVPSPRCILK
TCDFPDIRHGSLYSEDYYKPNFPVSVGRYYSYYCDKNFVTPSGHSWDYIYCRPKGWSPAV
PCFRQCNFHYLEHGNYPNYEKKYLQGQSVKVECYSGYSFPNEESLMTCTENGWPPPRCIH
VKTCSKSDIEIENGFFSESNFQYPLNKLTQYKCKPGYVTADGRTSGSITCLESGWSAQPT
CVKSCDMPLFENARAKSDGMWFKLNDTLDYVCHNGYESRDGHTTGSLVCGYDGWSDTATC
YERECSIPQIERYLNVEPKKDIYKVGDVLKFSCRQRLRRVGADSVQCYHFGWSPGFPTCK
WKVQSCHPPPQLPNGKVKGTQKEEYGHNEVVEYVCNPRFLLKGPNKIQCVDGEWPTLPIC
VEDKSTCGHIPDLDYGYVLFSTPPYRHGDSVEFNCREAFIMIGHRSITCIRGTWTQIPQC
IARDELETCKTSSLIAREAKLSQRTEFYHNTNVSYKCKGKYKHSVCINGRWDPEVTCREV
RIHSCPPPPQIPNAQDMTSTVNYRDGEKISVLCQEKYLIRGTEEIVCKDGRWQSIPRCVE
KIPCSQPPHIEHGTIKSSVSSEGRKQRFEPKLYVHNTRLSYICEDGFRLSGGNGITCHMG
KWSSPPQCVGIPCEPPPLIPHGVLSHELDSYQYGEEVMYSCTEGFVIDGPASIKCLGGKW
PRPPECIKTDCFSLPSFDDAILIGQKKESYRSGEQVSYKCPKYYQLDGSSIVQCIDGQWI
GRPTCRDVSCKKPPKVENAVIPNEMFRYPSGERVHYECIKPFDLFGETEVICLNGTWTDP
PQCKVSKRKCGSPPPIDNGDITTFPLPAYSPGSTVEYQCQSLYVLQGNKIITCRNGEWSK
PPKCLDACVISEEIMEEHKIQLRWKYQKKIYSKTGETAEFMCIPGYHKKTAPETFRATCR
EGKLLYPTCG
Download sequence
Identical sequences F6ZRH8
ENSECAP00000009652 9796.ENSECAP00000009652 ENSECAP00000009652

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]