SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000009653 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000009653
Domain Number 1 Region: 286-464
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.91e-52
Family BCR-homology GTPase activation domain (BH-domain) 0.00000223
Further Details:      
 
Domain Number 2 Region: 2-186
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.45e-40
Family BAR domain 0.0074
Further Details:      
 
Domain Number 3 Region: 160-261
Classification Level Classification E-value
Superfamily PH domain-like 2.75e-16
Family Pleckstrin-homology domain (PH domain) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000009653   Gene: ENSECAG00000011510   Transcript: ENSECAT00000012239
Sequence length 699
Comment pep:known_by_projection chromosome:EquCab2:X:50096046:50593874:-1 gene:ENSECAG00000011510 transcript:ENSECAT00000012239 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVHNASDLLIKPLENFRKEQIGFTKERKKKFEKDGERFYSLLDRHLHLSSKKKESQLQEA
DLQVDKERHNFFESSLDYVYQIQEVQESKKFNIVEPVLAFLHSLFISNSLTVELTQDFLP
YKQQLQLSLQNTRNHFSSTREEMEELKKRMKEAPQTCKLPGQPTIEGYLYTQEKWALGIS
WVKYYCQYEKETKTLTMTPMEQKPGAKQGPLDLTLKYCVRRKTESIDKRFCFDIETNERP
GTITLQALSEANRRLWMEAMDGKEPIYHSPITKQEEMELNEVGFKFVRKCINVIESKGIK
TEGLYRTVGSNIQVQKLLNAFFDPKCPGDVDFHDSDWDIKTITSSLKFYLRNLSEPVMTY
RLHKELVSAAKSDNLDYRLGAIHSLVYKLPEKNREMLELLIRHLVNVCEYSKENLMTPSN
MGVIFGPTLMRAQEDTVAAMMNIKFQNIVVEILIEHFVKIYSGPPEESAAPPVPPPRVTA
RRHKPITISKRLLRERTVFYTSSLDESEDEIQHQTPNGTITSTIDPPKLPQYPKLPIQRN
GETDPGRKSPSKPVADGKLESCPEVDVGKLVSRLQDGGTKAIPKTTNGPVPGFGPTKAPT
FHIKRPAPRPLVHPKEGDSDSFSKVRPPGDKPTIIRPPVRPPDPPCRVAAPQKPEPKPDI
VAGNAGEIPSSVVASRTRFFETASRKTGSSQGRLPGDES
Download sequence
Identical sequences F6ZRH0
ENSECAP00000009653 9796.ENSECAP00000009653 ENSECAP00000009653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]