SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000009660 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000009660
Domain Number 1 Region: 1172-1236
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.06e-20
Family Complement control module/SCR domain 0.0038
Further Details:      
 
Domain Number 2 Region: 143-213
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000486
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 3 Region: 85-146
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000524
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 4 Region: 930-991
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000498
Family Complement control module/SCR domain 0.00012
Further Details:      
 
Domain Number 5 Region: 1114-1173
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000157
Family Complement control module/SCR domain 0.00096
Further Details:      
 
Domain Number 6 Region: 1052-1108
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000616
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 7 Region: 627-684
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000721
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 8 Region: 689-744
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000275
Family Complement control module/SCR domain 0.00096
Further Details:      
 
Domain Number 9 Region: 988-1050
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000769
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 10 Region: 209-270
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000723
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 11 Region: 262-325
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000122
Family Complement control module/SCR domain 0.0031
Further Details:      
 
Domain Number 12 Region: 807-862
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000243
Family Complement control module/SCR domain 0.0026
Further Details:      
 
Domain Number 13 Region: 563-624
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000025
Family Complement control module/SCR domain 0.0033
Further Details:      
 
Domain Number 14 Region: 31-89
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000537
Family Complement control module/SCR domain 0.0031
Further Details:      
 
Domain Number 15 Region: 393-450
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000076
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 16 Region: 866-940
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000107
Family Complement control module/SCR domain 0.00016
Further Details:      
 
Domain Number 17 Region: 509-572
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000236
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 18 Region: 454-512
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000008
Family Complement control module/SCR domain 0.0028
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000009660
Domain Number - Region: 751-801
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000607
Family Complement control module/SCR domain 0.0035
Further Details:      
 
Domain Number - Region: 318-384
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0021
Family Complement control module/SCR domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000009660   Gene: ENSECAG00000011256   Transcript: ENSECAT00000012247
Sequence length 1242
Comment pep:known chromosome:EquCab2:30:24462153:24540348:1 gene:ENSECAG00000011256 transcript:ENSECAT00000012247 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLAAKIVWLVLWTVCVAEDCKEPPPRKQIEILSGSWPEQTYKEGTQATYKCRPGYRTLG
TITMQCRNGQWVALNPSRICRKRPCGHPGDTPFGSFHLAVGDEFTYGAKVVYTCVEGYQL
IGSINYRECDADGWTNDIPLCEVVKCLPVTEPENGRLISSALELDQEYTFGQVVRFECSS
GLMLDGPTEIHCSADGNWSGEKPRCVEISCQVPEILNGYAISQKTTFKEKERFQYKCNRG
FEYSERGDATCTKFGWSPIPSCREVTCDPPYIPNGVYSPRRTKHRTEDEIRYECTNGFYP
ATRGNTARCTSSGWVPSPRCSLKPCDFPEIKHGYLYAEDYYKPYFPVPIGKYYYYYCNQN
FVTPSKYRGGYIYCRAEGWSPAVPCLRQCTSTHLENGKFPHWGRTYLQGESVKVECYSGY
SLPDQQSLMTCTENGWSPPPRCIRVKTCSKSDIEIENGFISEPDFTYPFYKRAQYKCKPG
YVTADGKTSGSVICLQSGWSAQPSCIKYCDMPVFENARAKSNGTWFKLNYTLDYVCHDGY
ESRGRRSTGSIICGKDGWSDTATCYERECKIPQIERYLNVEPKNDIYKVGAVLKFSCRKR
HTIVGADSVQCYHFGWSPGFPTCKAEVRSCGPPPQLPNGEVKEAQKQEYGHSEVVECVCH
PGFLLKGSNKIQCVDGEWTTLPTCFEEESTCGDVPGLDHGYVELSAPPYRHGDSVEFTCR
EAFTMIGHKSIMCIRGMWTQLPQCIATDELAKCKWSKLITHEESYSHKIEFNHNANVSYK
CRGKYKHSTCVNGRWEPEVTCTEVQMQLCPPPPQIPNAQNMTTTVNYQDGEKIFILCKEE
YLIQRGEEIVCKDGRWQSIPRCVEKTPCSQPPHIEHGTIESSKSTEERKKRSEPKYYAHS
TRLNYICEDGFSLSEGDGIRCHMGKWSSPPQCVGIPCEPPALIPHGVLAHKLDSYQYGEE
VMYSCTEGFGIDGPASIKCLGGKWSDPPQCIKTDCLSLPVFNDTILIGQKKESYRSGEQV
AYKCPEYYQLDGSSFVQCINGKWIGRPTCRDVSCKKPPEVKNAITSNHMSRYPSGERVRY
ECIKPFYPFGEIEVTCLNGTWTDPPQCKDPKGKCGPPPPIDNGDITTFPSPAYPPGSTVE
YQCQSLHQLQGNRVITCRNGEWTKPPKCLDACVISEEKMEKHNIELRWRGEKKLYSETGD
VVEFACKPGYRAKRDSAEFRATCREGKLEYPTCERQRFNTRS
Download sequence
Identical sequences F6ZR63
9796.ENSECAP00000009660 ENSECAP00000009660 ENSECAP00000009660

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]