SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000010008 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000010008
Domain Number 1 Region: 60-132
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000584
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 2 Region: 115-186
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000025
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 3 Region: 184-246
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000139
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 4 Region: 2-65
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000931
Family Complement control module/SCR domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000010008   Gene: ENSECAG00000012244   Transcript: ENSECAT00000012672
Sequence length 311
Comment pep:novel chromosome:EquCab2:5:30661442:30680148:1 gene:ENSECAG00000012244 transcript:ENSECAT00000012672 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPTFETMQLKGKPDRVYFPGERLFYECRPAYERLFPYSLSTFCEHNGSWFPIEEACTRKK
CPTPQLKYGEVTSPNSSYMFDSEAHFLCDEGYHLVGRSILTCIRVGSNVRWDDIIPQCEL
ILCSPPGKIKNGKYTNSYMKSFEYNQFVTYSCNPSDGPEEYSLVGESQLTCSGPDTWSSD
PPECKVVKCELPVLEHGRAVSGIREKFSYLAVVIFECLQDFYLNGSHIVFCGGNSTWEPE
MPTCIKGFKPTHPTKPPVWNYPGYPNPREFLSLEDFEDLDRGIIALIVVTVVLGVAVVCT
CLYRCLQREKK
Download sequence
Identical sequences F6QHH0
ENSECAP00000010008 9796.ENSECAP00000010008 ENSECAP00000010008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]