SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000010227 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000010227
Domain Number 1 Region: 32-218
Classification Level Classification E-value
Superfamily vWA-like 4.28e-51
Family Integrin A (or I) domain 0.00031
Further Details:      
 
Domain Number 2 Region: 1027-1235
Classification Level Classification E-value
Superfamily vWA-like 8.73e-32
Family Integrin A (or I) domain 0.01
Further Details:      
 
Domain Number 3 Region: 597-772
Classification Level Classification E-value
Superfamily Fibronectin type III 1.08e-20
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 4 Region: 233-407
Classification Level Classification E-value
Superfamily Fibronectin type III 2.27e-20
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 5 Region: 779-958
Classification Level Classification E-value
Superfamily Fibronectin type III 3.83e-20
Family Fibronectin type III 0.0026
Further Details:      
 
Domain Number 6 Region: 421-588
Classification Level Classification E-value
Superfamily Fibronectin type III 4.79e-19
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 7 Region: 2865-2924
Classification Level Classification E-value
Superfamily BPTI-like 3.12e-16
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0015
Further Details:      
 
Domain Number 8 Region: 958-1043
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000178
Family Fibronectin type III 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000010227   Gene: ENSECAG00000011234   Transcript: ENSECAT00000012935
Sequence length 2936
Comment pep:known_by_projection chromosome:EquCab2:16:38374726:38405513:1 gene:ENSECAG00000011234 transcript:ENSECAT00000012935 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLRLLVAALCAGILAGALRVRAQHRERVTCTRLYAADIVFLLDGSSSIGRSNFREVRGF
LEGLVLPFSGAASAQGVRFAAVQYSDDPRTEFGLDALGSGGDVIHAIRELSYKGGNTRTG
AAILHVADHVFLPQLARPGVPKVCILITDGKSQDLVDTAAQRLKGQGVKLFAVGIKNADH
EELKRVASQPTSDFFFFVNDFSILRTLLPLVSRRVCTTAGGVPVILPPDGSTSGPRDLVL
SEPGSQSLRVQWTAASGPVTGYKVQYTPLTGLGQPLPSERREVSIPAGETSIQLQGLRPL
TEYQVTVVALYANSIGEAVSATAWTTALEGPELTIQNTTARSLLVAWQSVPGATGYRVTW
GVLSGGALQQQELGPGRGSVLLHDLEPGTDYEVTVSALLGHSVGSATSLTARTDTSVEQT
LRPVILGPTSILLSWNLVPEARGYRLEWRRESGLEVPEKVVLPSDVTRYQLDGLQPGTEY
RLTLYTLLEGREVATPATVVPTGPEMPVGPVTDLQATELPGQRVRVSWSPVPSATEYRIT
VRSTQGVERTLVLPGSQTAFDLDDVRAGLSYTVRVSARVGTHEGSASILTVRREPETPLA
IQGLRVMASDATWVRVAWGPVPGASGFRISWRTEDGPESSRTLPPGSTATDIMGLRPGTS
YQVAVSALRGREEGPPVVIVARTDPLGPVRTVHVTQTSSSSVTIAWNRVPGATGYRISWH
SGHGPEKSQLVSGEAMVAELDGLEPDTEYTVHVWPHVAGLEGTPASVVVRTNPEPVGSVS
KLQILNASSDVLRVTWVGVTGATAYRLAWGRSEGGPTRQQILPGNTDSAEIRGLEGGVSY
SVRVTALVGDREGAPVSIVVTTPPEAPPALETLHVVQRGEHSLSLRWQPVPGAQGFRLRW
RPEGGQEQSRVLGPELGSYELDGLEPATLYRVWLSVLGPAGEGPPVEVTAYTESPRVPST
ELRVVDTSIDSVTLAWTPVPGVSSYSLSWRPLRGPDQEMLGASQTLPGISSSQRVTGLEP
GISYIFSLTPVREGIQGPEASITQSPVCPHGLMDVVFLLHATRDNAHRAEAVKRALERLV
SALGPLGPQAVQIGLLSYSHRPSPLFPLNSSHDPGVILQKIRSIPYMDPSGNNLGIAVVT
AHRHLMAPDAPGRRQHVPGVMVLLVDEPLRGDIFNPVREAQAAGLKVMMLGLVGADPEQL
RRLVPSTDPVQNFFAVNDGSSLDQAVSSLATALCQTALATQPQPGPCSVHCPQGQKGEPG
EMGLKGQAGPPGPPGLPGRIGAPGPQGPPGSTIAKGERGFPGADGPPGNPGRPGIPGTPG
PKGSPGWPGPRGEPGERGPRGPKGEPGEPGQVRGGDGPGLPGQKGDPGPPGTPGSRGPLG
DPGPRGPPGLPGTAVKGDKGDRGERGPPGPGDGSTAPGEPGLPGLPGSPGPQGPVGPSGE
KGEKGDCEDGAPGLPGQPGTPGERGLQGPPGNVGPKGDRGLTGSVGETGEKGERGSPGPV
GPQGLPGVAGRPGAEGPEGPPGPAGRRGEKGEPGLPGVPAVVGPAGAGPKGEKGDVGPTG
PRGAPGVKGERGPPGLVFPGDPGPKGDPGDRGPIGLTGRAGPPGDSGPLGEKGDPGRPGP
PGPVGPRGRDGEVGEKGDEGPPGDPGLPGKAGERGLRGAPGARGPVGEKGDQGDPGEDGR
NGSPGPSGSKGDRGEPGPPGPPGQLVDTGLGAREKGEPGDRGQEGPRGPKGDPGPPGASG
ERGIAGLRGPPGPQGDPGIRGPAGEKGDRGPPGLDGRSGLDGKPGTSGPPGLHGATGKAG
DPGRDGLPGLRGEQGPPGPPGPPGALGKPGEDGKPGLNGKNGERGDPGEDGRKGEKGDSG
TPGRHGDDGPKGERGAPGSPGPQGPPGLPGQVGPSGQGFPGVPGSVGPKGDRGETGSKGE
QGLPGERGLRGEPGSMANVERLLENIGIKTSVLREIVETWDESSSGFRPVPERHRGPKGD
PGERGPPGKEGPIGFSGDRGPKGDRGDPGPQGPPGLALGERGPPGPPGLAGEPGKPGIPG
LPGPAGSVGEAGRPGERGERGEKGERGEQGRDGPPGIPGPPGPPGPKVAMDRPGPGLSGE
QGPPGLKGAKGEPGGDGERGPKGDRGVPGIKGDRGEPGQRGPDGSPGLLGERGVAGPEGK
PGLQGPRGTPGPEGGRGDPGPPGAPGLAGPSGPQGPSGLKGEPGETGPPGRGLPGPTGAV
GLPGPPGPSGLVGPQGAPGLPGQVGETGKPGAPGRDGASGKDGDRGAPGVPGSPGLPGPV
GPKGEPGPMGTPGQAVVGPPGAKGEKGAPGGLAGDLVGEPGAKGDRGLPGPRGEKGEAGR
AGEPGDPGEDGQKGAPGLKGNKGDPGVGVQGPSGPVGPPGLKGDLGPPGPPGAPGIVGFP
GQTGPRGEMGQPGPSGERGLAGLPGREGAPGPLGPPGPPGSVGAPGASGLKGDKGDPGVG
LPGARGERGEPGVRGEDGHPGQEGPRGLMGPPGSRGERGEKGDAGTTGLKGDKGDSAVAV
GPPGPQGAKGVMGERGPRGIDGDKGPRGESGNPGEKGAKGEPGDKGSAGASLRHLCFPQG
EPGAAGIPGDPGSPGKDGAPGVRGDKGDVGFMGPRGLKGERGVKGACGLDGEKGDKGEAG
PLGRPGLAGRKGDTGEPGVPGLSGAPGKEGLIGPKGDRGFDGQPGPKGDQGEKGERVTPR
NGGFPGPRSNDGSSGPPGPPGGVGPKGPEGLQGQKGERGPPGESVVGAPGAPGTPGERGE
QGRPGPAGPRGEKGEAALTEDDIRAFVRQEMSQHCACQGQFIASGSRPLPSYAADTAGPR
LHHVPVLRVSHAEEEGQVPPEDDEYEYSEYSVEEYQDPEAPWEGNDPCSLPLDEGSCTAY
TLRWYHRAVAGSTEACHPFVYGGCGGNANRFGTREACERRCPPRVVQSQGTGIGLS
Download sequence
Identical sequences F6SYJ1
ENSECAP00000010227

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]