SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000010260 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000010260
Domain Number 1 Region: 73-146
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 7.51e-17
Family Complement control module/SCR domain 0.00024
Further Details:      
 
Domain Number 2 Region: 198-259
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000236
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 3 Region: 130-200
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000917
Family Complement control module/SCR domain 0.00063
Further Details:      
 
Domain Number 4 Region: 10-83
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000249
Family Complement control module/SCR domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000010260   Gene: ENSECAG00000012425   Transcript: ENSECAT00000012975
Sequence length 261
Comment pep:novel chromosome:EquCab2:5:30716812:30730874:1 gene:ENSECAG00000012425 transcript:ENSECAT00000012975 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLILFFLDACGDPLRYESMKLKGVAQPRYSPGATVEYECRLGYMLKRPPLPTSARCQANN
TWTPLQEACTRKSCPHPGDPINGKVEYVNGTLTFGSQIHYFCNEGFNLIGTKILYCELVG
ETVNWSDNPPLCQVMYCRPPPKIQNGKHSRSDQEEFRYGEVVVYTCDPSNGPDEYSLVGE
SRLVCSGNDVWSSKPPECKVVKCEPPVLENGRVVSGFGKKFYYKATVVFDCLPGFYLSGN
NTIVCGANSAWEPAIPTCIKG
Download sequence
Identical sequences F6SQZ6
ENSECAP00000010260 9796.ENSECAP00000010260 ENSECAP00000010260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]