SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000010330 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000010330
Domain Number 1 Region: 3-148
Classification Level Classification E-value
Superfamily PR-1-like 6.15e-47
Family PR-1-like 0.0000000639
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000010330   Gene: ENSECAG00000012502   Transcript: ENSECAT00000013054
Sequence length 151
Comment pep:known_by_projection chromosome:EquCab2:25:1406919:1415452:1 gene:ENSECAG00000012502 transcript:ENSECAT00000013054 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AASKQFNDEVLKAHNEYRRQHGVPPLKLCKKLNREAQQYSEALASTRILKHSPESSRGQC
GENLAWASYDQTGKEVADRWYSEIKNYNFQQPGFTSGTGHFTAMVWKNTKKMGVGKASAS
DGSSFVVARYFPAGNVVNQGFFEENVLPPKK
Download sequence
Identical sequences F6RMQ1
ENSECAP00000010330 ENSECAP00000010330 9796.ENSECAP00000010330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]