SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000010339 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000010339
Domain Number 1 Region: 203-471
Classification Level Classification E-value
Superfamily vWA-like 2.23e-59
Family Integrin A (or I) domain 0.00000000838
Further Details:      
 
Domain Number 2 Region: 475-762
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.09e-56
Family Eukaryotic proteases 0.000000000495
Further Details:      
 
Domain Number 3 Region: 98-159
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000153
Family Complement control module/SCR domain 0.0000399
Further Details:      
 
Domain Number 4 Region: 164-220
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000347
Family Complement control module/SCR domain 0.0000294
Further Details:      
 
Domain Number 5 Region: 44-84
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000459
Family Complement control module/SCR domain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000010339   Gene: ENSECAG00000011854   Transcript: ENSECAT00000013066
Sequence length 768
Comment pep:known chromosome:EquCab2:20:31665420:31671369:1 gene:ENSECAG00000011854 transcript:ENSECAT00000013066 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSNLSPQLCLVPLVLGLLFGGVGVMPLAVAEPQASCSLTGVEIKGGSFQLLKEGQALEY
KCPSGFYPYPMQVRTCKSTGSWSTLKTQDQKIVKKAECRAIRCPRPQDFENGEYWPRAAY
YNLSDEISFRCYDGYTLRGSANRTCQENGRWDGQTAICDDGAGYCPNPGIPLGTRKVGSQ
YRLEDSVTYYCSRGLTLRGSQRRTCQEGGSWSGTEPSCQDSFMYDTPAEVAEAFLSSLTE
TIEGVEAEEGHSPGEQQKRKIVLDPSGSMNIYMVLDGSDSIGAHNFTRAKNCLRDFIEKV
ASYGVKPRYGLVTYATVPKVLIRVSQERSSDADWVTEKLNEISYEDHKLKTGTNTRKALQ
AVYSMMSWEGNAPPEGWNRTRHVILLMTDGLHNMGGDPVPVIHEIRDLLDIGRDRKNPRE
DYLDIYVFGVGPLVNQENINALASKKDGEQHVFKVKDMENLEDVFFQMLDETRTLGLCGM
VWEHRKGNDYDKQPWQAKISVTRPLKGHENCMGAVVSEYFVLTAAHCFTVDDQKHSIKVN
VGGNKKDLEIAEVLFHPNYNINGKKAEGISEFYDYDVALIKLKEKLTYGQTLRPICLPCT
EGTNQALRLPWSTTCQQQMEELLPAKDIKALFVSELSKEGKKMLVRKEVYIKNGEKKASC
ERDAQYASGYDKVKDISAVVTPRFLCTGGVNPYADPNTCRGDSGGPLIIHKRSRFIQVGV
ISWGVVDVCKDQRRQLQVPAHARDFHINLFQVLPWLKEKLKDEGLGFL
Download sequence
Identical sequences F6RMD0
XP_001492602.1.31192 XP_014696448.1.49734 ENSECAP00000010339 9796.ENSECAP00000010339 ENSECAP00000010339

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]