SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000010353 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000010353
Domain Number 1 Region: 24-672
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 8.14e-184
Family Neurolysin-like 2.45e-16
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000010353   Gene: ENSECAG00000011882   Transcript: ENSECAT00000013082
Sequence length 680
Comment pep:known_by_projection chromosome:EquCab2:7:1434005:1453897:1 gene:ENSECAG00000011882 transcript:ENSECAT00000013082 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPPAACAGDGLAAAAACSVVNYLQWDLSAQQIGERTAELIEQTKRVYDQVGAQAFEDVS
YESTLKALADVEVSYTVQRNILDFPQHVSPSKAIRTASTEADKRLSEFDVEMSMRQDVYQ
RIVWLQEKVQKDSLRPEASRYLERLIKLGRRNGLHLPAETQEKIKSIKKKLSLLCIDFNK
NLNEDMTFLPFTRDELGGLPEDFLNSLEKAGGEKLKVTLKYPHYFPLLKKCHVPETRRKV
EAAFNCRCKEENCAILRELVALRAQKSSLLGFSTHADYVLEMNMAKTSQVVATFLDELAQ
KLKPLGEQERAVILELKKAECEQRGLEFDGQINAWDMRYYMNQVEETRYSVDQNLLKEYF
PMQVVTRGLLGIYQELLGLTFDLEESATVWHEDVKLYSVRDVGSGQVIGKFYLDLYPREG
KYGHAACFGLQPGCLREDGSRQIAIAAMVANFTKPTPDAPSLLQHDEVETYFHEFGHVMH
QLCSQAEFAMFSGTHVERDFVEAPSQMLENWVWEKEPLLRMSQHYRTGSAIPPELLEKLI
KSRQANTGLFNLRQIVLAKVDQALHTQTAADPAEEYARLCQEILGVPATPGTNMPATFGH
LAGGYDAQYYGYLWSEVYSMDMFHTRFKQEGVLNGKVGMDYRSCILRPGGSQDASAMLKL
FLGRDPKQDAFLLSKGLQGS
Download sequence
Identical sequences F6REI4
ENSECAP00000010353

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]