SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000010509 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000010509
Domain Number 1 Region: 2-237
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.09e-59
Family BAR domain 0.0065
Further Details:      
 
Domain Number 2 Region: 340-519
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.55e-51
Family BCR-homology GTPase activation domain (BH-domain) 0.0000000172
Further Details:      
 
Domain Number 3 Region: 213-313
Classification Level Classification E-value
Superfamily PH domain-like 1.29e-18
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Domain Number 4 Region: 623-720
Classification Level Classification E-value
Superfamily SH3-domain 4.33e-17
Family SH3-domain 0.0000375
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000010509   Gene: ENSECAG00000012336   Transcript: ENSECAT00000013257
Sequence length 721
Comment pep:known_by_projection chromosome:EquCab2:14:33978983:34294733:-1 gene:ENSECAG00000012336 transcript:ENSECAT00000013257 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSSAKRKFADSLNEFKFQCIGDAETDDEMCIARSLQEFATVLRNLEDERIRMIENASEVL
ITPLEKFRKEQIGAAKEAKKKYDKETEKYCGILEKHLNLSSKKKESQLQEADSQVDLVRQ
HFYEVSLEYVFKVQEVQERKMFEFVEPLLAFLQGLFTFYHHGYELAKDFGDFKTQLTISI
QNTRNRFEGTRSEVESLMKKMKENPLEHKTISPYTMEGYLYVQEKRHFGTSWVKHYCTYQ
RDSKQITMVPFDQKSGGKGGEDESVTLKSCTRRKTDSIEKRFCFDVEAVDRPGVITMQAL
SEEDRRLWMEAMDGREPVYNSNKDSQSEGTAQLDSIGFSIIRKCIHAVETRGINEQGLYR
IVGVNSRVQKLLSVLMDPKTASETETDICAEWEIKTITSALKTYLRMLPGPLMMYQFQRS
FIKAAKLENQESRVSEIHSLVHRLPEKNRQMLQLLMNHLANVANNHKQNLMTVANLGVVF
GPTLLRPQEETVAAIMDIKFQNIVIEILIENHEKIFNTVPDTPLTNALLHLSRKKSSDSK
PPSCSERPLTLFHAVQSTEKQEQRNSIINSSLESVVSSNANSILNSSSSLQPNMNSSDPD
LDVLKPTRPNSLLSRKNVRPLMPSSPPNPSPTSPLSPSWPMFSAPSSPMPTSSTSSDSSP
ISTPFRKAKALYACKAEHDSELSFTAGTVFDNVHPSQEPGWLEGTLNGKTGLIPENYVEF
L
Download sequence
Identical sequences F6SGW4
ENSECAP00000010509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]