SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000010641 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000010641
Domain Number 1 Region: 127-328
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.06e-58
Family BCR-homology GTPase activation domain (BH-domain) 0.00011
Further Details:      
 
Domain Number 2 Region: 17-123
Classification Level Classification E-value
Superfamily PH domain-like 4.46e-32
Family Pleckstrin-homology domain (PH domain) 0.00022
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000010641
Domain Number - Region: 645-734
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00126
Family FCH domain 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000010641   Gene: ENSECAG00000012825   Transcript: ENSECAT00000013405
Sequence length 748
Comment pep:known_by_projection chromosome:EquCab2:3:51564790:51954392:-1 gene:ENSECAG00000012825 transcript:ENSECAT00000013405 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENSDSAELAQQGQGRSNAMKCGWLRKQGGFVKTWHTRWFVLKGDQLYYFKDEDETKPLG
TIFLPGNKVLEHPCNEESPGKFLFEVVPGGDRDRMTANHESYLLMASTQNDMEDWVKSIR
RVIWGPFGGGIFGQKLEDTVRYEKRYGNRLAPMLVEQCVDFIRQRGLKEEGLFRLPGQAN
LVKELQDAFDCGEKPSFDSNTDVHTVASLLKLYLRELPEPVIPYAKYEDFLSCAKLLSKE
EEAGVKELAKQVKSLPAVNYNLLKYICRFLDEVQSYSGVNKMSVQNLATVFGPNILRPKV
EDPLTIMEGTVVVQQLMSMMISKHDRLFPKDAELQTKPQDGVSNNNNEIQKKATMGQLQN
KENNNTKDSPGRRCSWDKSESPQRSSMDNGSPTALPGSKTNSPRNSVHKLDVSRSPPLMV
KKNPAFNKGSGIVTNGSFSSSNAEGLEKTQTTPNGSLQARRTSSLKSSGTKMGTHSVQNG
TVRMGILSTDTLGNPMNGRSMSWLPNGYVTLRDNKQKEQAGESGQHNRLSTYDNVHQQFS
MMNFDDKQSVDSATWSTSSCEISLPENSNSCRSSTTTCPEQDFYGGNFEDPVLDGPPQDD
LSHPGDYENKSDRRSVGGRSSRATSSSDNSETFVGNNSSNHSALHSLVSSLKQEMTKQKI
EYESRIKSLEQRNLTLETEMMSLHDELDQERKKFTMIEIKMRNAERAKEDAEKRNDMLQK
EMEQFFSTFGELTVEPRRSERGNTIWIQ
Download sequence
Identical sequences F6QLW2
ENSECAP00000010641 XP_001495166.1.31192 XP_008523003.1.77740 9796.ENSECAP00000010641 ENSECAP00000010641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]