SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000010723 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000010723
Domain Number 1 Region: 182-274
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.42e-25
Family UBX domain 0.0000115
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000010723   Gene: ENSECAG00000012944   Transcript: ENSECAT00000013504
Sequence length 276
Comment pep:known_by_projection chromosome:EquCab2:27:13698574:13721406:-1 gene:ENSECAG00000012944 transcript:ENSECAT00000013504 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASRGVVGIFLLSALPLLCLELRRGIPGLGIKDLILLCGRIFLLLALLTLIISVTTSWLN
SFKSSPVYLKEEEEKNEKRQKLVRKKQQEAQGEKASRYIENVLKPHQKMKLKKLEERFYQ
MMGETWKLSNGHKLGSGEDLVLENESQTSFETSNREAAKRRNLLKCLTKVSPPAEKPTQR
EVLDLPEEPPETAEEVVTVALRCPSGKVLRRRFFKSCSSQVLFDWMMKIGYHTSLYSLST
SFPRRPLEVEGGCSLQDVGITMDTVLNVEEKEQSHW
Download sequence
Identical sequences F6PH09
ENSECAP00000010723 9796.ENSECAP00000010723 XP_001495491.1.31192 XP_008539917.1.77740 ENSECAP00000010723

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]