SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000010811 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000010811
Domain Number 1 Region: 50-226
Classification Level Classification E-value
Superfamily PR-1-like 2.09e-52
Family PR-1-like 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000010811   Gene: ENSECAG00000013100   Transcript: ENSECAT00000013607
Sequence length 258
Comment pep:known_by_projection chromosome:EquCab2:9:11833629:11859445:-1 gene:ENSECAG00000013100 transcript:ENSECAT00000013607 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLASSAVCSILLFCLLCEASAVVLLNSTDSSPPTNNFTDIEAALKAQLDSADIPKARRKR
YISQNDMIAILDYHNQVRGKVFPPAANMEYMVWDENLAKSAEAWAATCIWDHGPSYLLRF
LGQNLSVRTGRYRSILQLVKPWYDEVKDYAFPYPQDCNPRCPMRCFGPMCTHYTQMVWAT
SNRIGCAIHTCQNMNVWGAVWRRAVYLVCNYAPKGNWIGEAPYKVGVPCSACPPSYGGSC
TDNLCFPGVTSNYLYWFK
Download sequence
Identical sequences F6RIQ5
9796.ENSECAP00000010811 XP_001491255.1.31192 XP_008512384.1.77740 XP_008512385.1.77740 XP_014583440.1.31192 XP_014709231.1.49734 XP_014709232.1.49734 ENSECAP00000010811 ENSECAP00000010811

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]