SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000011069 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000011069
Domain Number 1 Region: 327-584
Classification Level Classification E-value
Superfamily p53-like transcription factors 2.11e-98
Family STAT DNA-binding domain 0.0000614
Further Details:      
 
Domain Number 2 Region: 136-332
Classification Level Classification E-value
Superfamily STAT 1.41e-54
Family STAT 0.00017
Further Details:      
 
Domain Number 3 Region: 1-124
Classification Level Classification E-value
Superfamily Transcription factor STAT-4 N-domain 1.15e-39
Family Transcription factor STAT-4 N-domain 0.00034
Further Details:      
 
Domain Number 4 Region: 587-702
Classification Level Classification E-value
Superfamily SH2 domain 2.69e-34
Family SH2 domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000011069   Gene: ENSECAG00000012328   Transcript: ENSECAT00000013906
Sequence length 794
Comment pep:known_by_projection chromosome:EquCab2:11:20641425:20659599:-1 gene:ENSECAG00000012328 transcript:ENSECAT00000013906 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGWIQAQQLQGDALRQMQVLYGQHFPIEVRHYLAQWIESQPWDAIDLDNPQDQAQATQL
LEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMDLVRCIRHILYNEQRLV
QEANNGTSPAGILVDAMSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESL
RIQAQFAQLAQLNPQERLSRETALQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQLL
RKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLC
QQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGKL
NVHMNPPQVKATIISEQQAKSLLKNENTRNECSGEILNNCCVMEYHQATGTLSAHFRNMS
LKRIKRADRRGAESVTEEKFTVLFESQFSVGSNELVFQVKTLSLPVVVIVHGSQDHNATA
TVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNS
SSSHLEDYNSMAVSWAQFNRENLPGWNYTFWQWFDGVMEVLKKHHKPHWNDGAILGFVNK
QQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSPDRNLWNLKPFTTRDFSIRSLADRL
GDLNYLIYVFPDRPKDEVFSKYYTPVLAKAVDGYVKPQIKQVVPEFVSASADSAGGSATY
MDQAPSPAVCPQAHYNMYPQNPDPVLDQDGEFDLDETMDVARHVEELLRRPMDSLDPRLS
PPAGLFTSARGSLS
Download sequence
Identical sequences F6ZP14
ENSECAP00000011069 9796.ENSECAP00000011069 XP_001494788.1.31192 XP_014689240.1.49734 ENSECAP00000011069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]