SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000011232 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000011232
Domain Number 1 Region: 521-713
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.96e-55
Family Hemopexin-like domain 0.000000028
Further Details:      
 
Domain Number 2 Region: 88-215,389-444
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 9.62e-33
Family Matrix metalloproteases, catalytic domain 0.0000015
Further Details:      
 
Domain Number 3 Region: 274-331
Classification Level Classification E-value
Superfamily Kringle-like 1.2e-21
Family Fibronectin type II module 0.00014
Further Details:      
 
Domain Number 4 Region: 336-390
Classification Level Classification E-value
Superfamily Kringle-like 5.14e-21
Family Fibronectin type II module 0.00013
Further Details:      
 
Domain Number 5 Region: 219-273
Classification Level Classification E-value
Superfamily Kringle-like 1.57e-20
Family Fibronectin type II module 0.00015
Further Details:      
 
Domain Number 6 Region: 32-104
Classification Level Classification E-value
Superfamily PGBD-like 5.65e-19
Family MMP N-terminal domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000011232   Gene: ENSECAG00000013081   Transcript: ENSECAT00000014089
Sequence length 714
Comment pep:known chromosome:EquCab2:22:34936064:34943510:1 gene:ENSECAG00000013081 transcript:ENSECAT00000014089 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPWQSLVLAVLALGCCSAAPTRHQPTVVVFPGDLLTNLTDRELAEEYLFRYGYTGVAEM
SEGDQPLERALRRLQKRLALPETGELDSTTLEAMRTPRCGVPDVGQFQTFEGDLKWHHRD
ITYWIQNYSGDLPRDVIDDAFARAFAVWSEVTPLTFTRVNGPQADIVIQFGVREHGDGYP
FDGKDGLLAHAFPPGPGIQGDAHFDDEELWSLGKGPVVPTHFGNADGAPCHFPFTFEGRS
YSSCTTDGRSDDMLWCSTTADYDTDRRFGFCPSEKLYTQDGNADGKPCVFPFTFEGRSYS
TCTTDGRSDGYRWCATTANYDQDKRYGFCPTRVDSTVNGGNSAGELCVFPFTFLGKEYSA
CTREGRSDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPAALMY
PMYSFTEEPPLHEDDVNGIQYLYGPRPKPEPQPPTTTTLEPQTTVCATGPPTTRPSERPT
AGPTGPPSAGPTGPPSAGPPTNPPTAGPSTAPTVPLGPGEEVCNVDIFDAIAEIGNHLHF
FKDGRYWRLLEGKGRGVQGPFLIRDTWPMLPPKLDSAFEEPLTKKIFFFSGRQVWVYTGK
SALGPRRLDKLGLGADVAQITGALPRGGGKVLLFSRRRFWRFDVKTQTVDPRSVSPVDQM
FPGVPLDMHDVFQYREKAYFSQDRFYWRVSSRNEVNQVDQVGYVSFDLLQCPED
Download sequence
Identical sequences F7AGL5
ENSECAP00000011232 9796.ENSECAP00000011232 ENSECAP00000011232

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]